KEGG   Burkholderia cepacia DDS 7H-2: DM42_5463Help
Entry
DM42_5463         CDS       T03302                                 

Gene name
garD
Definition
(GenBank) galactarate dehydratase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00053  Ascorbate and aldarate metabolism
bced01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DM42_5463 (garD)
Enzymes [BR:bced01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     DM42_5463 (garD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF
Motif
Other DBs
NCBI-ProteinID: AIO44294
UniProt: A0A095E7R0
Position
2:2131898..2133451
Genome map
AA seq 517 aa AA seqDB search
MTASPLYIRVHPDDNVAIVVNDGGLPEGATFADGLTLCEGVPQGHKVALVDLAAGDPVVR
YNVVIGYALTDLRRGSWVNERTMRMPEPPGLDDLPLATRAAPPLEPLEGYTFEGFRNADG
SVGTRNILAITTTVQCVSGVVEHAVKRIKDELLPRYPNVDDVVGLEHTYGCGVAIDAPDA
DIPIRTLRNISLNPNFGGEVMTVSLGCEKLQPERLLPPGAIPVTADGATGNGGVVCLQDA
AHVGFNSMIDSIMKMAESHLERLNRRRRETCPASDLVVGVQCGGSDAFSGLTANPAVGFA
ADLLVRAGATIMFSEVTEVRDGVAQLTSRAANEDVAREIIREMDWYDRYLQRGRVDRSAN
TTPGNKKGGLSNIVEKAMGSIVKSGSAPIAGVVRPGDRARQKGLLYAATPASDFICGTLQ
LAAGMNLHIFTTGRGTPYGLAQVPVIKVATRSDLARRWHDLMDLDAGRIATGAATIEDTG
WELFRLMLDVASGKRRTWAEQWKLANALTLFNPAPVT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttccccgctctacatccgcgtgcatccggacgacaacgtcgcgatcgtcgtc
aacgacggcggtttgcccgaaggcgcgacgttcgccgacgggctgacgctgtgcgaaggc
gtgccgcaaggacacaaggtcgcgcttgtcgacctcgcggccggcgacccggtcgtgcgc
tacaacgtggtgatcggctatgcgctgaccgacctgcgccgcggcagctgggtcaacgag
cgcacgatgcgcatgcccgagccgccgggcctcgacgacctgccgctcgcgacgcgtgcc
gcgccgccgctcgagccgctcgaaggctatacgttcgagggtttccgcaacgccgacggt
tcggtcggcacgcgcaacatcctcgcgatcacgacgaccgtgcaatgcgtgtcgggcgtc
gtcgaacatgcggtgaagcggatcaaggacgaactgctgccgcgctacccgaacgtcgac
gacgtggtcgggctcgaacatacgtatggctgcggcgtcgcgatcgatgcgccggacgcc
gacatcccgatccgcacgctgcgcaacatcagcctgaatccgaatttcggcggcgaagtg
atgaccgtgagcctcggctgcgagaagctgcagcccgagcgtctgctgccgccgggcgcg
atcccggtgaccgccgacggcgcgaccggcaacggcggcgtcgtgtgcctgcaggatgcc
gcgcacgtcggcttcaattcgatgatcgactcgatcatgaagatggccgaatcgcatctc
gagcggctcaaccgccgccgtcgcgagacgtgtcccgcgtcggatctcgtcgtcggcgtg
cagtgcggcggcagcgacgcgttctcggggctcaccgcgaacccggcggtcggcttcgcg
gccgacctgctggtgcgtgcgggtgcaacgatcatgttctcggaagtgaccgaagtgcgc
gacggcgtcgcgcagctcacgtcgcgcgcggcgaacgaggacgtcgcccgcgagatcatt
cgcgagatggactggtacgaccgctacctgcagcgcggccgcgtcgaccgcagcgcgaac
acgacgccgggcaacaagaagggcgggctgtcgaacatcgtcgagaaagcgatggggtcg
atcgtgaagtcgggcagcgcgccgatcgccggcgtcgtgcgtcccggcgatcgggcgcgg
cagaaggggctgctgtacgcggcgacgcccgcgagcgatttcatctgcggcacgctgcag
ctcgcggcggggatgaacctgcacattttcacgaccggccgcggcacgccgtacggcctc
gcgcaggtgccggtgatcaaggtcgcgacgcgcagcgatctcgcgcgccgctggcacgac
ctgatggatctcgacgcagggcggatcgcgaccggcgcggcgacgatcgaggacacgggc
tgggaattgttccggctgatgctcgacgtcgccagcggcaagcgccgcacgtgggccgag
caatggaagctcgcgaatgcgctgacgctgttcaatccggcgccggtgacctga

DBGET integrated database retrieval system