KEGG   Burkholderia cepacia DDS 7H-2: DM42_5898Help
Entry
DM42_5898         CDS       T03302                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00071  Fatty acid degradation
bced00072  Synthesis and degradation of ketone bodies
bced00280  Valine, leucine and isoleucine degradation
bced00310  Lysine degradation
bced00362  Benzoate degradation
bced00380  Tryptophan metabolism
bced00620  Pyruvate metabolism
bced00630  Glyoxylate and dicarboxylate metabolism
bced00640  Propanoate metabolism
bced00650  Butanoate metabolism
bced00900  Terpenoid backbone biosynthesis
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
bced01200  Carbon metabolism
bced01212  Fatty acid metabolism
bced02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM42_5898
   00630 Glyoxylate and dicarboxylate metabolism
    DM42_5898
   00640 Propanoate metabolism
    DM42_5898
   00650 Butanoate metabolism
    DM42_5898
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM42_5898
   00072 Synthesis and degradation of ketone bodies
    DM42_5898
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM42_5898
   00310 Lysine degradation
    DM42_5898
   00380 Tryptophan metabolism
    DM42_5898
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM42_5898
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM42_5898
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM42_5898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bced04147]
    DM42_5898
Enzymes [BR:bced01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM42_5898
Exosome [BR:bced04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM42_5898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt UPF0731
Motif
Other DBs
NCBI-ProteinID: AIO44953
UniProt: A0A095EAP4
Position
2:complement(2655975..2657159)
Genome map
AA seq 394 aa AA seqDB search
MIDAVIVSTARTPIGKAYRGAFNLTHSPTLLGHAIRHAVLRAGIEPDRIEDAVIGSVLNA
GTAGGNIARHGVLAAGLPASVAAQTLDRQCASGLMAIATAAKQIMCDGMQVVVAGGQENI
SAVQTRYFEWTRADEDPNVLAAQPAAYMPMLETAEFVSRKYGISRDVQDQYALDSQLRTA
AAQAAGRFSSEIVPITTQKLVVDKATGTTSRHEVTLTQDEGNRPGTTLESLATLAPVIDG
GVVTAGNASQLSDGASACVLMNGKTAEQIGATPLGIYRGMTVVGNAPEEMGIGPIYAIPK
LLELHGLKTDDIGLWELNEAFACQALYCREKLGIDPARYNVNGGSISIGHPYGMTGARMV
GHALIEGKRRGARYVVVSMCVGGGMGAAGLFEVA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgctgtcatcgtttccaccgcacgtacgcccatcggaaaggcctatcgtggg
gcattcaacctcacgcactcgcctaccctgctcgggcacgcaatccggcacgcggtactg
cgtgccggcattgagccggatcgtatcgaagacgccgtgatcggttcggtactcaacgcc
gggaccgccggcggcaatatcgcccgacacggcgtgctggcggccggattgcctgccagc
gtcgctgcgcaaacactcgaccggcaatgtgcgtccggcctgatggcgatcgcgacggcc
gccaagcagatcatgtgcgacgggatgcaggttgtcgtggcgggcggccaggaaaacatc
tcggcggtacaaacgcgctacttcgagtggacccgcgccgacgaggaccccaatgtgctg
gccgcgcaacccgcggcctacatgccgatgctcgagaccgccgagttcgtttcccgcaag
tacgggatctcgcgggacgtccaggatcagtacgcactcgattcccagctccgcactgcc
gccgcacaagccgccggccgcttctcgagcgaaatcgttccgatcacgacacagaagctg
gtcgtcgacaaagcgaccggcacgacgtcgagacatgaggtcacgctcacgcaggacgag
ggaaatcgtcccggcacgacgctcgaatcgctggccacgctcgcaccggtaatcgacggc
ggcgttgtgacggcgggtaacgcgagccagctttcggacggtgcaagcgcctgcgtcctg
atgaacggaaaaaccgccgagcagatcggggccacccctctcggcatctatcggggcatg
accgtcgtcggcaatgcgccggaggagatgggcatcggtccgatctatgcgatccccaag
cttctggagcttcatggcctcaaaaccgacgacatcggcttatgggagctcaatgaggcg
tttgcctgccaagcgctgtactgccgtgagaagctgggaatcgatcccgcgcgatacaac
gtcaacggcggcagcatttctatcggccatccgtacgggatgaccggcgcacgcatggtc
ggtcatgccctgatcgaaggcaaaagacgcggtgcacgctacgtcgttgtttcgatgtgt
gtaggcggcggaatgggtgcggccggcttgttcgaagtcgcttga

DBGET integrated database retrieval system