KEGG   Burkholderia cepacia DDS 7H-2: DM42_6414Help
Entry
DM42_6414         CDS       T03302                                 

Definition
(GenBank) tRNA synthetases class I family protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00450  Selenocompound metabolism
bced00970  Aminoacyl-tRNA biosynthesis
bced01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DM42_6414
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM42_6414
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bced01007]
    DM42_6414
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bced03016]
    DM42_6414
Enzymes [BR:bced01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DM42_6414
Amino acid related enzymes [BR:bced01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DM42_6414
Transfer RNA biogenesis [BR:bced03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DM42_6414
 Prokaryotic type
   Other AARSs
    DM42_6414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1f zf_UBZ
Motif
Other DBs
NCBI-ProteinID: AIO43605
UniProt: A0A095FKR0
Position
3:29222..30817
Genome map
AA seq 531 aa AA seqDB search
MPIDTIRDPRHYLLVPAMPAPNGRLHLGHIAGPYLRLDMLARHLRSRGEVARIACASDPY
DSYIPLRAGQAGIDAAALARQSCAGIVDDLAAMNIDVDLFVDPLGDAHHDAYLAAHDGLV
ARLAAQRRVSTVRERMPYSAARDGYVTGSFLLGHCPQCARDVSGFFCEDCGAHFQPEDVR
EPSARWGETLAMREQDNLFFDIADPAALVAQLVGTETAPVFVDIARRHLARDGARFRLTS
HAGWGLPYVLDGEPRTLFGHGLLFGAIRFVGDLYARRHGLRANPFNRDSDVITVNGFGID
NCVSHLVGIQAMAMADGVSKPFDRFVINHFYTLEGRKFSTSLRWAIWVDDLAARTRVPAD
AVRGFVASTNPVAGRTDFDRDAFCRFVNGPYAKVRRHVAEAIGGPLAARVPTDETVRAAE
AAWRDAQRAMDFATFDPTAMAGIVERWSARFDGARAAGDLYGWTKGFALLAWPLMPALAQ
TAWRALGLRGEPNAGDFARLSSPVVTPLANFDPVTPGDLAAVLPPGMREVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgacacgatccgcgacccgcgccactacctgctcgtccccgcgatgccggcg
ccgaacgggcgcctgcacctcggtcatatcgcgggcccgtacctgcggctcgacatgctt
gcgcgtcatctgcgcagccgcggcgaggtcgcacgcatcgcatgcgcgagcgacccgtac
gattcctacatcccgctgcgcgccgggcaggccggcatcgacgcggcggcgctcgcgcgg
cagagctgcgcgggcatcgtcgacgatctcgccgcgatgaacatcgacgtcgacctgttc
gtcgatccgctcggcgatgcgcatcacgacgcgtacctcgccgcgcacgacgggctcgtc
gcacggctggccgcgcagcggcgcgtgtcgacggtgcgcgaacgcatgccgtattcggct
gcgcgcgacggttacgtgaccggcagttttctgctgggccattgcccgcagtgcgcgcgc
gacgtgtcgggattcttctgcgaggactgcggcgcgcatttccagccggaagacgtgcgc
gaaccgtcggcacgctggggcgagacgctcgcgatgcgcgagcaggacaacctgttcttc
gacatcgcggacccggccgcgctggtcgcgcaactggtgggcaccgagaccgcgccggtg
ttcgtcgatatcgcgcgccgccatctggcgcgcgacggcgcgcgtttccgcctgacgagc
catgccggctgggggttgccgtatgtgctggacggcgagccgcgcacgctgttcgggcac
gggctgctgttcggcgcgatccgcttcgtcggcgatctctacgcgcgcaggcacgggctg
cgcgccaacccgttcaatcgcgattcggacgtgatcaccgtcaacggcttcgggatcgac
aactgcgtgtcgcatctggtcggcatccaggcgatggcgatggccgacggcgtgtcgaag
ccgttcgatcgcttcgtgatcaatcatttctatacgctggaggggcgcaagttctcgacg
agcctgcgttgggcgatctgggtcgacgacctcgcggcgcgcacgcgcgtgccggccgat
gcggtgcgcggcttcgtcgcgtcgaccaatccggttgccgggcgcacggacttcgatcgc
gacgcgttctgccggttcgtgaacgggccgtacgcgaaggtgcgccggcatgtggccgag
gcaatcggcgggccgctcgccgcgcgcgtgccgaccgacgagacggtgcgggcagcggag
gcggcgtggcgcgacgcgcagcgcgcgatggatttcgcgacgttcgacccgacggcgatg
gccggcatcgtcgagcgctggagcgcgcgcttcgacggcgcgcgcgcggccggcgacctg
tacggctggaccaagggtttcgcgctgctcgcgtggccgttgatgccggcgctcgcgcag
accgcgtggcgggcgctcggcttgcgcggcgagccgaacgcgggcgacttcgcacggttg
tcgtcgccggtcgtcacgccgctggcgaacttcgacccggttacgccgggagatctggcg
gcggtcctgccgcccggcatgcgggaggtcgcatga

DBGET integrated database retrieval system