KEGG   Burkholderia cepacia DDS 7H-2: DM42_674Help
Entry
DM42_674          CDS       T03302                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00625  Chloroalkane and chloroalkene degradation
bced00680  Methane metabolism
bced01100  Metabolic pathways
bced01120  Microbial metabolism in diverse environments
bced01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    DM42_674 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM42_674 (fdhA)
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     DM42_674 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AIO46910
UniProt: A0A095EP97
Position
1:762653..763867
Genome map
AA seq 404 aa AA seqDB search
MTPTGNRIVTFEKPLEMKVNTFKFPELITPQGKSAPHGAILKIVTTNICGSDLHIYRGSF
AVPKGMTMGHEMTGEVIEVGSDVEVVKKGDIVSVPFNVGCGRCYNCKHMRSDVCENTNPE
IDCGAYGFNLGGWTGGQGDYLFVPYADFNLLRFPDKDAAMEKIRDLTLLSDVLPTAFHGF
AGPDWPAAPAYVVGENILIFGAGPVGRAGAACARLLGAGAIIVADYIQERLDLLKPHGVE
TINLSDGVPIEEHLERITGHREVDRVIDYVGVDCRGFGAEADKIVESAVTNAMLKYVRFG
GMTSTVGVYCANPISKDPKAKKGHMDLEWSNAWIKSPRMSAGQSPTANYNHALMRAILND
RMPYLSPMMNTKFIKLEDAPAAYKEFDAGSAYKYVIDPHGSVRH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactccgaccggtaaccgaatcgtgactttcgagaagcccttggaaatgaaggtcaac
accttcaaatttccagagctgataacccctcaagggaaaagcgcaccccatggcgctatc
ctcaaaatagttaccacaaatatctgtggcagcgaccttcacatttatcgcggttcgttt
gctgttcccaagggaatgaccatgggccatgaaatgaccggcgaagtgatcgaagtggga
tcagacgtcgaagtcgtgaagaagggcgacatcgtttccgttcccttcaatgtggggtgt
gggcgttgctacaactgcaagcatatgcgctccgatgtatgcgagaacaccaaccccgaa
atcgactgcggagcctacgggttcaacctcggtggctggacgggggggcaaggtgattat
ctcttcgtaccgtatgcggatttcaatctccttcgcttccctgacaaggatgccgccatg
gaaaaaatccgcgacctgacccttctctctgacgtattacccacagctttccatgggttc
gctggcccagactggccagccgcgccggcctacgtcgtcggcgaaaacatcctgatcttc
ggtgccgggccggtcggcagagcgggtgccgcctgcgccagacttctgggtgcaggcgcc
atcatcgttgccgattacattcaagagcggctggaccttctcaagccacacggcgtggaa
accatcaacctttccgacggcgtgccgatcgaggagcatctcgaacgcattaccgggcac
agggaggtggatcgcgtcatcgactatgttggtgtggactgccgcgggtttggcgcggag
gctgacaagatcgtggagagcgctgttaccaacgcaatgctcaaatatgtccgcttcggc
ggaatgaccagtacggtcggtgtgtactgcgcaaacccgatctcgaaagacccgaaagcc
aagaaaggccatatggatctggaatggtccaacgcctggatcaagtcgccgcgaatgtcg
gctggtcaatctccgacggccaactacaaccacgcgttaatgcgggcgatactgaacgat
cgcatgccttacctttcgccgatgatgaacactaagttcatcaagctcgaagacgcgccc
gccgcgtacaaagagttcgacgcgggttctgcatacaagtacgtcatcgacccgcatggt
tcagtgcggcattaa

DBGET integrated database retrieval system