KEGG   Brucella ceti TE28753-12: V568_100295Help
Entry
V568_100295       CDS       T02935                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00071  Fatty acid degradation
bcee00072  Synthesis and degradation of ketone bodies
bcee00280  Valine, leucine and isoleucine degradation
bcee00310  Lysine degradation
bcee00362  Benzoate degradation
bcee00380  Tryptophan metabolism
bcee00620  Pyruvate metabolism
bcee00630  Glyoxylate and dicarboxylate metabolism
bcee00640  Propanoate metabolism
bcee00650  Butanoate metabolism
bcee00900  Terpenoid backbone biosynthesis
bcee01100  Metabolic pathways
bcee01110  Biosynthesis of secondary metabolites
bcee01120  Microbial metabolism in diverse environments
bcee01130  Biosynthesis of antibiotics
bcee01200  Carbon metabolism
bcee01212  Fatty acid metabolism
bcee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V568_100295
   00630 Glyoxylate and dicarboxylate metabolism
    V568_100295
   00640 Propanoate metabolism
    V568_100295
   00650 Butanoate metabolism
    V568_100295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V568_100295
   00072 Synthesis and degradation of ketone bodies
    V568_100295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V568_100295
   00310 Lysine degradation
    V568_100295
   00380 Tryptophan metabolism
    V568_100295
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V568_100295
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V568_100295
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V568_100295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcee04147]
    V568_100295
Enzymes [BR:bcee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V568_100295
Exosome [BR:bcee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V568_100295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHB01497
Position
1:284011..284976
Genome map
AA seq 321 aa AA seqDB search
MGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQESMSMAPHCAYLRSG
VKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEFALASQHKAEAAQK
AGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKEGTVTAGNASGIND
DAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRKALEKAGWSVGDLD
LVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVLTTLLYEMERRDAK
RGLATLCIGGGMGVTLCVERD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggggccggttgcccgaaggaaaccaccgcttttgccatcaaccagctctgcggttcc
ggcctgcgggcggttgcgctcgggatgcagcagattgtttccggcgatgcgaagattatc
gtggcgggcgggcaggaatccatgtccatggcgccgcattgtgcctatctgcgctccggc
gtgaagatgggcgatttcaagatgatcgacaccatgctgaaagacggcctgaccgatgct
ttccatggctatcacatgggcatcaccgctgaaaatattgcgcgccaatggcagttgagc
cgcagcgagcaggacgagttcgcactcgcctcgcagcacaaagccgaggccgcgcagaag
gcaggccgcttcgatgaggagatcgtgcctttcaccgtcaaggcccgcaagggggatgtt
gtggtttcggcagatgaatatatccgtccgggcacgacgatggaggtgctggccaagctg
aagccggcttttgacaaggaaggcacggtgacggcgggcaatgcatccggcatcaatgac
gatgccgcagcggttgtgctgatggatgctggcgaggcagccaggcgtggcgtgaagcct
ctggcgcgcatcgtatcctgggcgacggctggcgttgatccgtcgatcatgggaaccggg
ccgattcccgcaacgcggaaggcgctggaaaaggcaggctggagcgttggcgaccttgat
cttgttgaggccaatgaggcctttgcagcgcagtcatgcgcggtggtgcgcgatctgggt
ctcaatcctgaaatcgtcaatgtcaatggcggcgcaatcgccatcggccatccgatcggc
gcctccggcgcccgcgtgctgacgacgctgctctacgaaatggagcgtcgcgatgccaag
cgtggtctggcgacgctttgtatcggcggcggcatgggcgtgaccctttgtgtcgagcgg
gattga

DBGET integrated database retrieval system