KEGG   Brucella ceti TE28753-12: V568_102267Help
Entry
V568_102267       CDS       T02935                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00270  Cysteine and methionine metabolism
bcee00480  Glutathione metabolism
bcee01100  Metabolic pathways
Module
bcee_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    V568_102267
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    V568_102267
Enzymes [BR:bcee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     V568_102267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AHB02796
Position
1:complement(2054633..2055571)
Genome map
AA seq 312 aa AA seqDB search
MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARMEKMEV
RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR
NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL
TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR
PEQSKLTPREREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI
AALFWDAVEARR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaagtcgcggtccagatggaccatatcagcacggtgaacatcacgggcgat
accactttcgctctctcgcttgaggcgcaaaagcgcggccacgagcttttccattatacg
cccgaccggctttccatgcgcgatggcgtggtttccgcccgcatggaaaagatggaagtg
cgcgatgtgaagggcgatcattacacgctgggcgagcctgtccgccgcgacctcacggaa
atggatgtgatcctgctgcgccaggatccgccttttgacatgaattacatcaccacgacg
catcttctggaacgcatccatccaaagacgctggtggtcaacgatccggcctgggtgcgc
aacagcccggaaaagatttttgtcaccgaatttcccgacctgatgccggaaacgctcatc
accaaggatccgcaggaggtgatggatttccgccgtgaattcggcgacatcatcctgaag
ccgctttacggcaatggcggcgcgggcgtcttccatctggcggatggtgaccgcaacctt
acctcgcttctggaaatgttcggccagcttttcagggagccgttcatcgcgcagcgctat
ctgaaagatgtgcgggcgggcgacaagcgtatcatcctcatcgatggcgagccggtgggc
gcgctgaaccgcgtgccgtccgaaaccgacgcacgctccaacatgcatgtgggcggacgc
cccgaacagagcaagttgaccccgcgtgagcgtgaaatctgcgcgcgcattggcccctcg
ctgaaagagcgcggcttcatcctcgtcggcatcgacgtgattggcgactacatgacggaa
atcaacgtgacgtcgccgacaggtatccgtgaaatcgaacgttttgacggcaccaatatt
gccgccctgttctgggatgcggtggaagccagacgataa

DBGET integrated database retrieval system