KEGG   Brucella ceti TE28753-12: V568_200622Help
Entry
V568_200622       CDS       T02935                                 

Definition
(GenBank) hypothetical protein
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00250  Alanine, aspartate and glutamate metabolism
bcee00330  Arginine and proline metabolism
bcee01100  Metabolic pathways
bcee01110  Biosynthesis of secondary metabolites
bcee01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    V568_200622
   00330 Arginine and proline metabolism
    V568_200622
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bcee03000]
    V568_200622
Enzymes [BR:bcee01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     V568_200622
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     V568_200622
Transcription factors [BR:bcee03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    V568_200622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg Psu
Motif
Other DBs
NCBI-ProteinID: AHB03246
Position
2:574198..577239
Genome map
AA seq 1013 aa AA seqDB search
MCLAEALLRIPDMATRDALIRDKISNGDWKSHIGGGRSLFVNAATWGLVVTGKLTNTVND
RGLSAALTRLIARCGEPVIRRGVDMAMRMMGEQFVTGETIDEALKRAKELEERGFRYSYD
MLGEAATTAADAERYYKDYETAIHAIGRASAGRGIYDGPGISIKLSALHPRYTRAQSERV
MGELLPKVKALAAIAKSYNIGLNIDAEEADRLELSLDLLQSLCEDPDLAGWDGIGFVVQA
YGKRCPFVLDFIIDLARRTKRRVMVRLVKGAYWDAEIKRAQVDGLEDFPVYTRKVHTDVS
YIACARKLLAATDVIFPQFATHNAQTLATIYHLAGPDFKTGKFEFQCLHGMGEPLYDEVV
GPEKLGRPARIYAPVGTHETLLAYLVRRLLENGANSSFVNRIGDKNVSVDELIADPVEVV
RSMAVVGARHDQIALPENLYGARRNSAGFDLSNEVTLAELSKTLKETAGRAWTAEPQVAG
AKVKGVSRPVLNPGDRNDVVGTVTEIAEADVAKAMKAAQTATTSWSAVAPAERAACLERA
ADIMQRDMPALLGLVMREAGKSMPNAIAEVREAIDFLRYYAEQTRRTLGVGHKALGPVVC
ISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRILHEGGIPADALQLLPGD
GRIGAALVAAPETCGVMFTGSTEVARLIQAQLASRLLPNGKPVPLIAETGGQNAMIVDSS
ALAEQVVFDVIASAFDSAGQRCSALRVLCLQEDVADRILTMLKGALRELSIGRTDQLKVD
IGPVITDEAKNTIEKHIQAMRDLGRKVEQLPLGPETQNGTFVAPTIIEIESLRDLKREVF
GPVLHVVRYKRDDMESLIDDINSTGYGLTFGLHTRLDETIANVADRIRVGNIYINRNIIG
AVVGVQPFGGRGLSGTGPKAGGPLYLGRLVETAPIPPRHASVHTDAALKDFARWLGNRGM
NDLAQAARDTGSASALGLELKLPGPVGERNLYALHPRGACFWSPRPKLASIAN
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgtgccttgccgaagccttgctgcgcattcccgatatggcgacgcgcgatgcgctgatc
cgcgacaagatatcgaatggcgactggaaatcccacattggcggcgggcgctcgcttttc
gtcaatgctgcgacatggggcctggtcgttaccggcaagctcaccaataccgtcaatgat
cgtggcctttccgccgctcttacccgcctcatcgcccgctgcggcgagccggtcatccgt
cgcggcgtggacatggccatgcgcatgatgggcgagcagttcgtcaccggcgaaaccatc
gatgaggcgttgaaacgcgccaaggagctggaagagcgcggcttccgctattcctacgac
atgctgggcgaggccgcgaccaccgccgccgatgcagagcgttattataaggattatgaa
accgcgatccacgccatcggtcgtgcttccgcagggcgcggcatttatgatggtcccggc
atttccatcaagctttcggcgcttcacccgcgttatacccgcgcgcaaagtgagcgcgtc
atgggtgaacttctgccgaaggtgaaggcactcgcggccatcgccaagtcctataatatc
ggcctcaatatcgacgcggaggaggccgaccgtcttgaactgtcgctcgacctgttgcaa
agcctttgcgaagaccctgatctggcaggctgggatggcatcggcttcgtggtgcaggcc
tatggcaagcgctgccccttcgtgcttgatttcatcatcgatctggctcgccgcaccaag
cgccgcgtcatggtgcgtctggtgaagggcgcctattgggatgcggagatcaagcgtgcg
caggtggatgggctggaggattttccggtctatacccgcaaggtgcatacggacgtttcc
tatattgcctgcgcgcgcaagcttctggccgcgacggatgtgatctttccgcaatttgcg
acccataacgcgcagacactcgccacgatctatcatctggccgggccggatttcaaaacc
ggtaagtttgagttccaatgcctgcacggcatgggtgagccgctttatgatgaagtcgtc
ggccccgaaaagctcggtcgcccggcccgcatttatgcaccggtcggcacgcatgaaacg
ctgctcgcctatctcgtccgccgccttcttgaaaacggcgcgaactcctccttcgtcaac
cgtattggcgacaaaaacgtctcggtcgatgagctgatcgccgatccggtggaagtcgtc
cggtcgatggctgtcgtcggtgcgcgtcatgaccagattgcgctgccggaaaatctctat
ggcgcgcgccgcaattccgcaggctttgatctttccaatgaggtgacgcttgcggaactg
agcaaaaccttgaaggaaacggcaggccgtgcatggaccgccgaaccgcaggtggcgggt
gcaaaggtgaagggcgtaagccgtccggttctcaatcccggcgaccggaatgatgttgtc
ggcaccgtaacggaaatcgcagaggccgatgtggcaaaggcgatgaaggcagcgcaaacc
gcgaccacaagctggtccgcggttgcgcccgcagaacgcgccgcctgtctggagcgcgca
gccgatatcatgcagcgcgacatgccggctctgctcggcctcgtcatgcgcgaggcgggc
aagtccatgccgaacgccattgccgaagtgcgtgaagccatcgatttcctgcgctattat
gccgaacagacccgccgcacgcttggcgtcggccacaaggcgcttggccctgtcgtctgc
atcagcccgtggaacttcccgctggcaatcttcaccggccagattgcggctgcacttgtt
gcaggcaatccggttctggcaaagcctgccgaggaaaccccgctgatcgccgctgagggc
gtgcgcattctgcatgaggggggcattccggcggatgcgctccagcttctgccgggtgat
ggccgcattggcgccgcgctggttgcagcaccggaaacttgcggcgtaatgttcaccggc
tccaccgaggtggcgcggctcatccaggcgcagcttgcctcgcgcctgctgccgaacgga
aagccggtcccgctcattgccgaaacgggcggtcagaacgccatgatcgtggattcctcg
gcacttgccgagcaggtggtgtttgatgtcatcgcttcggctttcgatagcgccggccag
cgctgttcggcgctgcgtgtcctctgcttgcaggaagatgtggccgaccgcattctcacc
atgctcaagggcgccttgcgtgagctttccattggccgcacggaccagctcaaggtcgat
atcggcccggttatcaccgatgaggcgaagaacaccattgaaaagcatattcaggccatg
cgcgatcttggccgcaaggtggaacagcttccccttggcccggaaacgcagaacggcact
tttgttgcgccgacaatcatcgagattgaatcgctgcgcgatctcaagcgcgaagtgttc
ggcccggtcctgcatgtggttcgttacaagcgcgacgacatggaaagcctgatcgatgat
atcaattcgaccggctatgggcttacttttggtttgcatacgcgccttgacgagacgatt
gccaatgttgcggatcgcatccgtgtcggcaatatctatatcaatcgcaacattatcggc
gcagtggtgggcgtgcagcctttcggcgggcgtggcctttccggcaccggcccgaaggcg
ggcggtccgctctatcttggccgtctggtcgaaaccgcgccgatcccgccgcgtcacgct
tcggttcataccgatgcggcgctgaaggactttgcccgctggctcggcaatcgcggcatg
aacgatctggcgcaggcggcgcgcgataccggcagtgcttcggcgctcggtctcgaactc
aaactgccgggcccggttggcgagcgcaatctctatgctctccacccgcgcggcgcgtgc
ttctggtcccccagaccgaaattggcctctatcgccaattga

DBGET integrated database retrieval system