KEGG   Brucella ceti TE28753-12: V568_200677Help
Entry
V568_200677       CDS       T02935                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00010  Glycolysis / Gluconeogenesis
bcee00053  Ascorbate and aldarate metabolism
bcee00071  Fatty acid degradation
bcee00280  Valine, leucine and isoleucine degradation
bcee00310  Lysine degradation
bcee00330  Arginine and proline metabolism
bcee00340  Histidine metabolism
bcee00380  Tryptophan metabolism
bcee00410  beta-Alanine metabolism
bcee00561  Glycerolipid metabolism
bcee00620  Pyruvate metabolism
bcee00625  Chloroalkane and chloroalkene degradation
bcee00903  Limonene and pinene degradation
bcee01100  Metabolic pathways
bcee01110  Biosynthesis of secondary metabolites
bcee01120  Microbial metabolism in diverse environments
bcee01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    V568_200677
   00053 Ascorbate and aldarate metabolism
    V568_200677
   00620 Pyruvate metabolism
    V568_200677
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V568_200677
   00561 Glycerolipid metabolism
    V568_200677
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V568_200677
   00310 Lysine degradation
    V568_200677
   00330 Arginine and proline metabolism
    V568_200677
   00340 Histidine metabolism
    V568_200677
   00380 Tryptophan metabolism
    V568_200677
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    V568_200677
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    V568_200677
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    V568_200677
Enzymes [BR:bcee01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     V568_200677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHB03286
Position
2:complement(627963..629144)
Genome map
AA seq 393 aa AA seqDB search
MAKTISMEMGAPIKLARESQAAAGLSHTKAFIAACENFEVEEVLSPKYPNQTVVHEPIGV
CGLITPWNWPMNQITLKVIPAIAVGCTVVLKPSEIAPMSAMLFAEFVDQAGLPKGVFNLV
NGEGPVVGEALSQHPEVDMMSFTGSTRAGTAVSRAAAATVKRVSLELGGKSPNIVFADSD
LEKAISRSLAHCFENTGQSCNAPTRMLVERSVYDKAVELAKKAAESTKVGDPAQEGDHIG
PLSSSIQFEKVQALIQKGIDEGARLVAGGTGRPEGFTEGDYVKPTVFADVNNNMTIAREE
IFGPVLAMIPFDTEEEAIAIANDTPYGLAAYIQTGSPERAKRVARKLRAGMIQINGTSRA
PGSPFGGYKQSGNGRKGGKWGLEDFMEVKLISG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaccatttcgatggaaatgggcgcaccaatcaagcttgcgcgcgaatcacag
gccgcagccggcctgtcgcacaccaaggcattcatcgccgcttgcgaaaattttgaggtt
gaggaagtcctctcccccaaatatccaaaccagaccgtcgtgcatgagccaatcggcgtt
tgcggcctcatcacgccatggaactggccaatgaaccagatcacgctcaaggtgatcccg
gccattgctgtcggctgcacggtggttttgaagccttccgaaatagcgccgatgtcggcc
atgctttttgccgaatttgtcgatcaggcgggcctgccgaaaggtgttttcaacctcgtc
aatggcgaaggtccggtcgtgggcgaagccctttcgcagcaccccgaagtggacatgatg
tcgtttaccggctcgacgcgcgccggaacggccgtttcgcgcgcggcagcagcaaccgta
aaacgcgtttcgctggagcttggcggcaaatcgcccaatatcgtcttcgccgatagcgat
ctggaaaaggcaatttcccgcagcctcgcccattgctttgagaataccggccagtcctgc
aacgcaccgacacgtatgctggtggaacgctcggtctatgataaggctgtggagcttgca
aaaaaagcagcggaaagcaccaaggtcggcgatccggcgcaggaaggggaccatatcggc
ccgctttcttcctctatccagttcgagaaggttcaggcgctcatccagaagggcattgac
gaaggtgcgcgccttgttgcgggcggcacggggcgcccggaaggctttaccgagggcgat
tatgtgaagccgaccgtctttgcggacgtcaacaacaacatgaccatcgcacgcgaggaa
atcttcggcccggtgctggccatgatccccttcgatacggaagaagaagccatcgccatt
gccaatgacacaccttacggtcttgcagcctatatccagaccggcagcccggaacgcgcc
aaacgcgttgcccgcaagttgcgcgcgggcatgatacagatcaacggcacctcccgtgcg
ccgggaagcccctttggcggctacaagcaatccggcaatggccgtaaaggcggcaagtgg
gggctggaagacttcatggaagtaaagctcatcagcggctga

DBGET integrated database retrieval system