KEGG   Brucella ceti TE28753-12: V568_200751Help
Entry
V568_200751       CDS       T02935                                 

Definition
(GenBank) glutamyl-tRNA(gln) amidotransferase subunit a
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00970  Aminoacyl-tRNA biosynthesis
bcee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    V568_200751
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcee03029]
    V568_200751
Enzymes [BR:bcee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     V568_200751
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     V568_200751
Mitochondrial biogenesis [BR:bcee03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    V568_200751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHB03332
Position
2:692145..693221
Genome map
AA seq 358 aa AA seqDB search
MSELTALTIAEARDKLKAKAITATELTDAYLSAIDAANDAINAYVAVTHDQARSMAKASD
ERIAKGEAGALEGIPLGVKDLFATKGVHTQACSHILDGFKPEYESTVTANLWADGAVMLG
KLNMDEFAMGSSNETSYYGPVKNPWRAKGSNADLVPGGSSGGSAAAVAAHLCAGATATDT
GGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFASSLDQAGPIARDVRDAAILMKSMASLDL
KDTTSVDLPVPDYEAALGRSVKGMKIGIPREYRVDGMPGEIEELWQKGIQYLKDAGARLS
IFRCRIPNMRCLLIISWRLRKLRPTSHVMMAFVMACACPARILPTCTNRPAPQASARK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgaccgcactgaccattgccgaagcgcgcgacaagttgaaagccaaggcc
attaccgcgaccgagctgacggacgcctatctttccgctatcgatgccgccaatgacgcc
atcaatgcctatgtggccgtcacccacgatcaggcgcgttccatggccaaggcttcggat
gaacgcatcgcgaagggcgaagcgggcgcattggagggcattccgctcggcgtgaaggac
ctgtttgcaaccaagggcgtgcacacgcaggcctgctcgcacattctggacggtttcaag
ccggaatatgaatcgaccgtcaccgccaatttatgggctgatggcgcggtcatgctcggc
aagctcaatatggatgagttcgccatgggctcctccaacgaaacttcctattacggtccg
gtgaaaaatccgtggcgcgccaagggttccaatgccgatctggtgccgggcggctcgtcc
ggcggttcggctgccgccgttgccgcgcatctttgcgcgggcgcgactgcgaccgatacg
ggcggctcgatccgccagcctgccgcctttaccggtacggtcggcatcaagccaacctat
ggccgtgtttcgcgctggggtacggtggctttcgcctcgtcgctcgatcaggcaggcccg
attgcgcgcgacgtgcgcgatgctgcgatccttatgaagtccatggcttcgctcgatctc
aaggacacaacttccgttgacctgccggtgccggattatgaagcagccctcggcaggtct
gtgaagggcatgaagatcggcattccaagggaatatcgtgtcgatggcatgccgggcgaa
atcgaggaactctggcagaagggcatccagtatctgaaggatgcaggtgcgagattgtcg
atatttcgctgccgcataccaaatatgcgctgcctgcttattatatcgtggcgcctgcgg
aagcttcgtccaacctcgcacgttatgatggcgttcgttatggcctgcgcgtgcccggca
aggatattgccgacatgtacgaacagacccgcgccgcaggcttcggcaaggaagtga

DBGET integrated database retrieval system