KEGG   Bacillus cereus FT9: BcrFT9_03134Help
Entry
BcrFT9_03134      CDS       T03417                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00071  Fatty acid degradation
bcef00280  Valine, leucine and isoleucine degradation
bcef00310  Lysine degradation
bcef00362  Benzoate degradation
bcef00380  Tryptophan metabolism
bcef00620  Pyruvate metabolism
bcef00630  Glyoxylate and dicarboxylate metabolism
bcef00640  Propanoate metabolism
bcef00650  Butanoate metabolism
bcef00900  Terpenoid backbone biosynthesis
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01120  Microbial metabolism in diverse environments
bcef01130  Biosynthesis of antibiotics
bcef01200  Carbon metabolism
bcef01212  Fatty acid metabolism
bcef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BcrFT9_03134
   00630 Glyoxylate and dicarboxylate metabolism
    BcrFT9_03134
   00640 Propanoate metabolism
    BcrFT9_03134
   00650 Butanoate metabolism
    BcrFT9_03134
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BcrFT9_03134
   00072 Synthesis and degradation of ketone bodies
    BcrFT9_03134
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BcrFT9_03134
   00310 Lysine degradation
    BcrFT9_03134
   00380 Tryptophan metabolism
    BcrFT9_03134
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BcrFT9_03134
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BcrFT9_03134
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BcrFT9_03134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcef04147]
    BcrFT9_03134
Enzymes [BR:bcef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BcrFT9_03134
Exosome [BR:bcef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BcrFT9_03134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIE80671
UniProt: A0A063CLR2
Position
complement(3813472..3814647)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVIAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagcggttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggttatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaattcaattaggtgtaagtgatgttgttattgcaggtggagtagaagcaatgagttca
agcccttatgcattaaaacagcaccgctggggacaacgtctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacgataaaagaacgtagaaaagaagtagtattttcaaaggatgaacatccacgtgct
gatattacagcagaaaaattagcaggattaaaaccagctttccgaaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagtgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatgggtattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggtagcattatttatagaagcactataa

DBGET integrated database retrieval system