KEGG   Bacillus cereus FT9: BcrFT9_03430Help
Entry
BcrFT9_03430      CDS       T03417                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00790  Folate biosynthesis
bcef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BcrFT9_03430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcef04147]
    BcrFT9_03430
Enzymes [BR:bcef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BcrFT9_03430
Exosome [BR:bcef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BcrFT9_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a FBA
Motif
Other DBs
NCBI-ProteinID: AIE80966
UniProt: A0A068NBT0
Position
4114910..4115224
Genome map
AA seq 104 aa AA seqDB search
MMLRLTEEEVQEELLKLDKWVVKDEKWIERKYMFSDYLKGVEFVSEAAKLSEEHNHHPFI
LIQYKAVIITLSSWNAKGLTKLDFELAKQFDELFIQNEKAIIRK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacgattaactgaagaagaagttcaagaggaattattgaagttagataaatgg
gtagtaaaagatgaaaaatggattgaaagaaaatatatgttttccgactacttaaaagga
gtcgaatttgtctctgaagccgccaaactatcagaagaacataatcaccacccatttatc
cttatccagtataaagcagtcattattactttgtcatcttggaatgcaaaaggtttaacg
aaactcgattttgagcttgcgaagcaatttgatgaactatttatccaaaatgaaaaagcc
attataagaaagtaa

DBGET integrated database retrieval system