KEGG   Bacillus cereus FT9: BcrFT9_04338Help
Entry
BcrFT9_04338      CDS       T03417                                 

Definition
(GenBank) Homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00270  Cysteine and methionine metabolism
bcef00920  Sulfur metabolism
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01130  Biosynthesis of antibiotics
bcef01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BcrFT9_04338
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BcrFT9_04338
Enzymes [BR:bcef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BcrFT9_04338
    2.3.1.46  homoserine O-succinyltransferase
     BcrFT9_04338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase DUF5416
Motif
Other DBs
NCBI-ProteinID: AIE81842
UniProt: A0A063CKH7
Structure
PDB: 

Position
complement(5117226..5118131)
Genome map
AA seq 301 aa AA seqDB search
MPIIIDKDLPARKVLQEENIFVMTKERAETQDIRALKIAILNLMPTKQETEAQLLRLIGN
TPLQLDVHLLHMESHLSRNVAQEHLTSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDY
WEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVPKYPLKEKMFGVFEHEVREQHVKLL
QGFDELFFAPHSRHTEVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSC
DTLKQEYERDRQKGLNIDVPKNYFKHNNPNEKPLVRWRSHGNLLFSNWLNYYVYQETPYV
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcataattgataaagatttaccagctcgcaaagtgttgcaggaggaaaatatt
tttgtaatgacaaaagagcgagcagaaacacaagatatccgggcattgaaaattgctata
ttaaatttaatgcctacaaagcaagaaacagaagcgcaactacttcgtttaattggaaat
acaccattgcaattagatgttcatttacttcatatggaatcacatctgtcccgtaatgta
gcacaggaacatttaacaagtttttataaaacattccgtgatattgagaatgagaaattt
gatggactcattattacaggagcaccagttgaaactctttcttttgaagaggtagattat
tgggaagagcttaaacgtattatggagtattcaaaaacgaatgtaacatctacgcttcat
atttgctggggggcacaggctggtttgtatcatcattatggcgttccaaagtatcctctt
aaggaaaaaatgtttggtgtatttgaacatgaagtccgtgagcaacatgtgaaactgtta
caaggttttgatgaattgttttttgccccgcattcgcgtcatacagaagtacgagagagt
gatattagagaggtgaaagaattaacattattggcaaactctgaggaagcaggtgttcac
cttgttattgggcaagaaggaagacaagtgtttgcgctcgggcatagtgaatatagttgt
gatacgttaaagcaagaatacgaacgggaccgccaaaaagggttaaatattgatgtgccg
aaaaactattttaagcataataatccaaatgagaagccgcttgtaaggtggagaagccat
gggaatctattattctctaattggctaaattattacgtgtatcaagaaaccccttatgta
ttataa

DBGET integrated database retrieval system