KEGG   Bacteroides cellulosilyticus: BcellWH2_01201Help
Entry
BcellWH2_01201    CDS       T04116                                 

Definition
(GenBank) D-lyxose ketol-isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bcel  Bacteroides cellulosilyticus
Pathway
bcel00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bcel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BcellWH2_01201
Enzymes [BR:bcel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BcellWH2_01201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4995
Motif
Other DBs
NCBI-ProteinID: ALJ58463
UniProt: A0A0P0GKS2
Position
complement(1297301..1297981)
Genome map
AA seq 226 aa AA seqDB search
MRLKKVLTLALIAACGMGLASCTAESKKTEQVMTQEKATYQKKYTNADFYKDGKFDQEAA
KEAFLDMFKFYGVPYTPLMEKDIWFTDFGLGDFENVGMGGIFWVNDPEYGYFAHAIYLLP
GQMIPEHAHVKTAFPAKHESWMVNHGWVYNFSEVGDETPNAPAVPASHGPIKSKNFVKQN
VGDVLRLKELGTFHFMMAGPEGAIVDEWACYHDNDGLRFTNGQAAL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaaaaaagtattaaccctggcattaattgccgcctgcggtatgggactcgct
tcttgtacggcagaatctaaaaaaacagaacaagttatgacacaggaaaaggcaacgtat
cagaagaagtacacgaatgctgacttctacaaagacggaaagtttgaccaggaagctgct
aaagaagcattccttgatatgtttaaattttatggcgtgccttacactccgctgatggag
aaagatatctggtttacagatttcggtttgggcgactttgagaatgtaggtatgggaggc
atcttctgggtaaacgatcctgaatatggctattttgcacatgctatttacttgttgccg
ggacagatgattccggaacatgcccatgtaaaaacggcattccctgcgaaacatgagtcg
tggatggtaaatcacggttgggtttataacttctccgaagtaggagatgaaacaccgaat
gctcctgcggttccggcatctcacggtcctatcaagagcaagaatttcgtgaaacagaat
gtgggtgatgttctccgtctgaaagaactgggtactttccactttatgatggccggtcct
gagggagccattgtagatgagtgggcatgttaccatgataatgatggtctgcgttttact
aatggacaggctgctttgtaa

DBGET integrated database retrieval system