KEGG   Bacteroides cellulosilyticus: BcellWH2_01357Help
Entry
BcellWH2_01357    CDS       T04116                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bcel  Bacteroides cellulosilyticus
Pathway
bcel00260  Glycine, serine and threonine metabolism
bcel01100  Metabolic pathways
bcel01110  Biosynthesis of secondary metabolites
bcel01120  Microbial metabolism in diverse environments
bcel01130  Biosynthesis of antibiotics
bcel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BcellWH2_01357 (ltaE)
Enzymes [BR:bcel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BcellWH2_01357 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALJ58618
UniProt: A0A0P0GKP1
Position
complement(1511619..1512638)
Genome map
AA seq 339 aa AA seqDB search
MRSFASDNNSGVHPLVMEALNRANQNHAVGYGDDPWTKEAVRKIKETFSPDCEPLFVFNG
TGSNAVALQLATRPYNLILCAETAHIYVDECGAPARMTGCQIRPIATPDGKLTPELIRPY
LKNFGEQHHSQPGAVYISQCSELGTVYTPEELKALTTLAHEYGMYVHMDGARLANACVAL
NLSFKELTVDCGIDILSFGGTKNGLMLGESVIIFNSDLKKEALYVRKQSAQLASKLRYLS
CQFTAYLTDDLWKKNAAHANAMARKLYEGLQTLPDVQFTQKMESNQLFLTMPRPVIDRLM
KSYFFYFWNEAENEIRFVTSFDTTEEDIQSLLQAVKDSF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagaagttttgcttcagacaacaattccggtgtacatccattggtgatggaggcgctg
aaccgggcaaaccaaaatcacgcagttggctatggtgacgatccttggactaaggaagcc
gttcgcaaaattaaagagacattttcgcctgattgtgagccactgtttgtcttcaatgga
acaggaagtaatgcggtagctttgcagttggctacccgcccttataatttaattctttgt
gcggagactgcacatatttacgtagatgaatgtggggcacctgcccgtatgacgggatgc
cagatacgtcctattgcaacgccggatggtaaactgacgccggagttgatacgtccttat
ctgaagaacttcggggaacagcatcattctcaaccgggtgctgtttatatttctcaatgt
tcggaattaggtactgtctatactccggaagaattgaaagcgctgactaccttggcgcat
gaatatggtatgtatgtgcacatggatggggcacgtttagcgaatgcttgtgttgcgttg
aatctcagcttcaaggaactgacagtggattgtggcattgatattcttagtttcggtgga
acgaagaatggattgatgttaggtgaaagtgtaataatcttcaattcggacctgaaaaag
gaagcgctctatgtacggaaacagtcggctcagttagcttctaaattgcgttacctttct
tgtcagtttacagcgtatcttacggatgatttgtggaaaaagaatgctgcacatgccaat
gcgatggcacgtaaactatatgaagggttgcaaacattgccggatgtacaattcacacaa
aagatggagagtaatcagttgttcctgactatgcctcgtccggttattgatagattgatg
aagtcttacttcttttatttctggaatgaagctgaaaatgaaattcgttttgtgacctct
tttgatacgacagaagaagatattcagtctttgttgcaggcagtgaaggatagtttctga

DBGET integrated database retrieval system