KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_1023Help
Entry
DM39_1023         CDS       T03308                                 

Definition
(GenBank) ABC transporter family protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM39_1023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcen02000]
    DM39_1023
Enzymes [BR:bcen01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     DM39_1023
Transporters [BR:bcen02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DM39_1023
   Histidine transporter
    DM39_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_15 AAA_29 AAA_16 AAA_23 APS_kinase AAA_28 DUF87 AAA_33 PRK G-alpha FtsK_SpoIIIE NACHT AAA_22 RYDR_ITPR AAA_24 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIO33173
UniProt: A0A088U7E1
Position
1:1085021..1085821
Genome map
AA seq 266 aa AA seqDB search
MAEITQTSASASVKLAAVDIHKRYGDNEVLKGVSLNAKAGDVISIIGASGSGKSTFLRCI
NFLERPNAGQIVVDGEAVRTKTDKAGALEVADHKQLQRIRTKLAMVFQHFNLWAHMNVLE
NVMEAPVHVLGISKKEAEERAREYLEKVGLPPRVEKQYPSHLSGGQQQRVAIARALAMHP
DVMLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTE
EEGDPKEVLVRPQSERLKQFLSGSLK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagatcactcaaacgagcgcgtccgcttccgtgaagcttgccgcggtcgacatt
cacaagcgctacggcgacaacgaggtgctcaagggcgtgtcgctgaacgcgaaagcgggc
gacgtcatcagcatcatcggcgcgagcggctcgggcaagagcacgttcctgcgctgcatc
aatttcctcgagcggccgaatgcggggcagatcgtcgtcgacggcgaggccgtgcgcacg
aagaccgacaaggccggtgcgctcgaggtggccgatcacaagcagctgcagcgcattcgc
acgaagctcgcgatggtgttccagcacttcaatctgtgggcgcacatgaacgtgctcgag
aacgtgatggaagcgcccgtgcacgtgctcggcatttcgaagaaggaagccgaggagcgt
gcgcgcgagtatctggagaaggtcggcctgccgccgcgcgtcgagaagcagtatccgtcg
cacctgtcgggcggccagcagcagcgtgtcgcgatcgcgcgcgcgctggcgatgcatccc
gacgtgatgctgttcgacgagcccacttcggcgctcgatccggaactcgtcggcgaagtg
ctgaaggtgatgcagaagctggccgaggaaggccgcacgatgatcgtcgtcacgcacgag
atgggttttgcgcgcaacgtgtcgaaccacgtgatgttcctgcaccaggggcggaccgag
gaagagggcgatccgaaggaggtgctggtgcgcccgcagagcgagcgtttgaagcagttc
ctgtcgggcagcctcaagtaa

DBGET integrated database retrieval system