KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_1091Help
Entry
DM39_1091         CDS       T03308                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DM39_1091 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcen03400]
    DM39_1091 (recC)
Enzymes [BR:bcen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DM39_1091 (recC)
DNA repair and recombination proteins [BR:bcen03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DM39_1091 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AIO32004
UniProt: A0A088URD6
Position
1:1172375..1175713
Genome map
AA seq 1112 aa AA seqDB search
MLQLFYSNRHETLADALLDDLAAFPARNGPWAPQQIIVPSAALRRRLELDIAARHGVCAN
VEFTYLAQWLWTQIGRVLTVPARSPFAPDRLVWRCYRLFAQAADGAPWLASPRLAAYLSA
SDDAMRYELAHRVASVLDHYLTYRPEWLAAWQAGESVLAGDAAPRGIGDAARDDERWQAA
LWRALLAELSDSGTPPAHRFLADARHLDADAIARIDWPESVSVFALPTMPPLHIALLREL
SRWIDVRVYALNPCREFWFDIVTAAHAEALDAAGRLDYQEVGHPLLAEWGRQTQAQLHML
HELTESAALGDASRFVENPAPTWLARVQNAILDLQPEAALGEPPAERGIEVHVCHSLARQ
LEVLHDRLLAWFDADPSLQPSDVLVAVADLAAAGPLIDAVFGTAGAGGARVPYRITGLPP
SQANPVARVLLDWLALPDRQVGAPELVEWLRVDAVAARYGIDANALETVQTWLAAAGARR
GLAPVAHDDAAVPAPRHTFADALARLFLGYAMPDGAAPVGAWLPIEAATGSEAELLGRLA
RFTDDLDGFARRLADAHTPRAWSELFADTLARFFDSGAAYADALAGVRDALDAMLAAMTE
GAADEALPAAVVRAGLAAALDDPARGGVPWGGVTFSSLTSLRGLPYRVVCLLGMDDGVLP
SLARADEFDLMAVLPKLGDRQRRDDERNLFLDLLLAARDRLLIAYTGRSIRDNAPLPPAA
LVDELLDHLALVTAGPDAAPDAVDAARRAFIVEHPLQPFAAAYFRPDSALVSYDAERATL
ASLLAADASRDGPREQPFFAQPLPPEPVEPVAFSEFERFWRHPARALLRARLGIVLADAQ
AELLDTEPFALDFAGSDALAARVLPLLIESDEARVHDHALRIADASPELPGGATGAVWRD
QALGSLSQLASSVRRALADGTEQRPFALDIMPAWPDTGQALFGADDAALSRDALGAPLEL
HGTLNRLTPAGQIIYRYARPSARDYLSAWLAHLVYCAIDPAGPRRTLWFGTGGAFELTPV
AAPREQLAPLAALFRAGRRMPLRFFPRSAWACVSDGEAKAASVWINERVVSEADDPAIAI
AWRGAHPSLDEPFGTLARLVFEPLVEHLKELA
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgctccagctcttctattcgaatcgccacgaaacgctggccgacgcgctgctcgacgat
ctggccgcgttcccggcccgcaacggcccgtgggcgccgcagcagatcatcgtgccgagc
gcggcgctgcggcgtcggctcgaactcgacatcgccgcgcgccacggcgtgtgcgcgaac
gtcgagttcacgtatctcgcgcaatggctgtggacgcagatcggccgcgtgctgacggtg
cccgcgcgctcgccgttcgcgcccgaccgcctcgtgtggcgctgctaccggctgttcgcg
caggcggccgacggcgcgccgtggcttgcgtcgccgcggctcgccgcctatctgtccgcg
tccgacgacgcgatgcgctacgagctcgcgcaccgcgtcgcgagcgtgctcgatcactac
ctgacctatcggcccgaatggctcgccgcgtggcaggccggcgagtcggtgctggccggc
gacgccgcgccgcgcgggatcggcgatgccgcgcgcgatgacgagcgctggcaggccgcg
ctgtggcgcgcgctgctcgcggagttgagcgacagcggcacgccgcccgcgcatcgcttc
ctcgccgacgcgcgccatctcgatgccgacgcgatcgcgcggatcgactggcccgaatcg
gtcagcgtgttcgcgctgccgacgatgccgcccttgcacatcgcgctgctgcgcgagctg
tcgcgctggatcgacgtgcgcgtctatgcgctgaacccgtgccgcgaattctggttcgac
atcgtgaccgccgcgcatgccgaggcgctcgatgcggccggccggctcgactatcaggaa
gtcggccatccgctgctggccgagtggggccggcagacgcaggcgcagctgcacatgctg
cacgagctgaccgaaagcgcggcgctcggcgatgcgtcgcggttcgtcgagaatcccgcg
ccgacctggctcgcgcgcgtgcagaacgcgatcctcgacctgcagccggaggccgcgctg
ggcgagccgccggccgagcgcggcatcgaggtgcatgtatgccacagcctcgcgcgccag
ctcgaagtgctgcacgaccgcctgctcgcctggttcgacgcggacccgagcctgcagccg
tccgacgtgctggtcgcggtcgccgatctcgcggcggccgggccgctgatcgatgcggtg
ttcggcaccgcgggcgccggcggcgcgcgcgtgccgtaccggatcacgggcctgccgccg
tcgcaggcgaacccggtcgcgcgcgtgctgctcgactggctcgcgctgccggaccggcag
gtcggcgcgccggagctggtcgaatggctgcgcgtcgacgcggtggcggcccgctacggg
atcgacgcgaacgcgctcgagacggtgcagacctggctcgcggcggccggcgcgcggcgc
gggctcgcgccggtcgcgcacgacgacgcggccgtgccggcgccgcgccatacgttcgcc
gatgcgctcgcgcggctgtttctcggctatgcgatgcccgacggcgccgcgccggtcggc
gcgtggctgccgatcgaggcggccaccggcagcgaggccgagctgctcggccggcttgcg
cgcttcaccgacgatctcgacggctttgcgcggcggctggccgacgcgcacacgccgcgc
gcgtggagcgaactgttcgccgacacgctcgcgcgcttcttcgactcgggcgcggcctac
gcggacgcgctcgcgggcgtgcgcgacgcgctcgacgcgatgctggccgcgatgaccgaa
ggcgcggccgacgaggcgctgccggccgccgtcgtgcgcgcgggcctcgctgccgcgctc
gacgatcccgcgcgcggcggcgtgccgtggggcggcgtcacgttctcgtcgctgacgagc
ctgcgcgggctgccgtatcgcgtcgtgtgcctgctcggcatggacgacggcgtgctgccg
agcctcgcgcgcgccgacgaattcgacctgatggccgtcttgccgaagctcggcgatcgt
cagcgccgcgacgacgagcgcaacctgtttctcgacctgctgctggccgcgcgcgaccgg
ctgctgatcgcgtacacgggccgcagcattcgcgacaacgcgccgctgccgcccgcggcg
ctcgtcgacgaactgctcgaccatctcgcgctcgtcacggccgggcccgacgccgcgccg
gatgcggtcgatgccgcgcgccgcgcgttcatcgtcgagcatccgctgcagccgttcgcg
gccgcgtatttccggcccgacagcgcgctggtgtcgtacgacgccgaacgcgcgacgctc
gcgtcgctgctggccgccgatgcatcgcgcgatgggccgcgcgagcagccgttcttcgcg
cagccgctgccgcccgaaccggtcgagccggtcgcgttcagcgagttcgaacgtttctgg
cgccaccccgcgcgcgcgttgctgcgcgcgcgcctcggcatcgtgctggccgatgcgcag
gccgaactgctcgataccgagccgttcgcgctcgacttcgcgggcagcgacgcgctcgcc
gcgcgcgtgctgccgctgctgatcgaatcggacgaggcgcgcgtgcacgaccacgcgctg
cgcatcgcggacgcgagccccgagttgccgggcggcgcgaccggcgccgtgtggcgcgac
caggcgctcggctcgctgtcgcagcttgcgtcgagcgtgcgccgcgcgctggccgacggc
accgagcagcgaccgttcgcgctcgacatcatgccggcatggccggacaccgggcaggcg
ctgttcggcgccgacgacgcggcgctgtcgcgcgacgcgctgggcgcgccgctcgaactg
cacggcacgctgaaccggctgacgccggccgggcagatcatctatcgctatgcacggccg
agcgcgcgcgactatttgtccgcgtggctcgcgcatctcgtctactgcgcgatcgatccc
gccgggccgcgccgcacgctgtggttcggcaccggcggcgcgttcgagctgacgccggtc
gcggcgccgcgcgagcagctcgcgccgctcgccgcgctgtttcgcgccggacggcgcatg
ccgctgcgcttctttccgcgcagcgcatgggcgtgcgtctccgacggcgaagcgaaggcc
gcgagcgtgtggatcaacgagcgcgtcgtcagcgaggccgacgatccggcgatcgcgatc
gcatggcgcggcgcgcatccgtcgctcgacgagccgttcggcacgctggcgcggctcgtg
ttcgagccgctcgtcgaacatctgaaggagctcgcatga

DBGET integrated database retrieval system