KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_2522Help
Entry
DM39_2522         CDS       T03308                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00450  Selenocompound metabolism
bcen00970  Aminoacyl-tRNA biosynthesis
bcen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DM39_2522 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM39_2522 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcen01007]
    DM39_2522 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcen03016]
    DM39_2522 (metG)
Enzymes [BR:bcen01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DM39_2522 (metG)
Amino acid related enzymes [BR:bcen01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DM39_2522 (metG)
Transfer RNA biogenesis [BR:bcen03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DM39_2522 (metG)
 Prokaryotic type
   Other AARSs
    DM39_2522 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AIO31894
UniProt: A0A088UQZ2
Position
1:2749739..2751895
Genome map
AA seq 718 aa AA seqDB search
MSASDLTSVQAAAPQGRRQILVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYY
IGADDTHGTPVMLRAEKEGLTPKQLIERVWTEHKRDFDSFGVSFDNFYSTDSEENRVLSE
KIYLALKENGLIAEREIEQAYDPVKEMFLPDRFIKGECPKCHAKDQYGDSCEVCGSTYLP
TELLNPYSVVSGATPVRKTSTHYFFRLSDPRCESFLREWVGGLAQPEATNKMREWLGDAG
EAKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCERNGVDFDAWIRPG
STAEQYHFIGKDILYFHTLFWPAMLEFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQ
SYIDTGLNPEWLRYYFAAKLNATMEDLDLNLEDFQARVNSDLVGKYVNIASRAAGFLIKR
FDGRVQDSAMNHPLVAKLRDAIPQIAAQYEAREYGRALRHTMELADEVNAYVDGAKPWEL
AKDPANAVALHETCSVSLEAFRLLSLALKPVMPRVAEAVEAFFGIAPLAWADAAKPLSSA
QPIRAYQHLMTRVDAKQIEALLAANRDSLQADAAGAAAAGAAAAKEAKQAKANAKPAAVN
GTDGDAPISIDDFAKVDLRIAKIVACQAVEGSDKLLQLTLDIGEEKTRNVFSGIKSAYQP
EQLVGKLTVMVANLAPRKMKFGLSEGMVLAASASDEKAEPGLYILEPHSGAKPGMRVK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatccgacctcacttccgtgcaggccgcggcgccgcaaggccgccgccagatc
ctcgtcacgtccgccctgccctacgccaacggccagatccatatcggccacctggtcgag
tacatccagaccgatatctgggtgcggacgctgcgaatgcacgggcacgaggtctactac
atcggcgccgacgacacgcacggcacgccggtcatgctgcgcgcggagaaggaaggcctg
accccgaagcagctgatcgagcgcgtgtggaccgagcacaagcgcgacttcgacagtttc
ggcgtgtcgttcgacaacttctactcgaccgactccgaagaaaaccgcgtgctgagcgag
aagatctatctcgcgctgaaggaaaacgggctgatcgccgagcgcgagatcgagcaggcg
tacgacccggtcaaggaaatgttcctgccggaccgcttcatcaagggcgagtgcccgaag
tgccacgcgaaggaccagtacggcgacagctgcgaagtgtgcggctcgacctatctcccg
accgagctgctgaacccgtattcggtcgtgtcgggcgcgacgcccgtgcgcaagacctcg
acgcactacttcttccgcctgtccgacccgcgctgcgagtcgttcctgcgtgaatgggtc
ggcggcctcgcgcaacccgaggcgaccaacaagatgcgcgaatggctcggcgacgccggc
gaggcgaagctcgccgactgggacatctcgcgcgacgcgccgtacttcggcttcgagatc
ccgggcgcgcccggcaagtatttctacgtgtggctcgacgcgccggtcggctactacgcg
agcttcaagaacctgtgcgagcgcaacggcgtcgacttcgacgcatggatccgcccgggc
tcgaccgccgagcagtatcacttcatcggcaaggacatcctgtatttccatacgctgttc
tggccggcgatgctcgagttctcgggccaccgcacgccgaccaacgtgttcgcgcacggc
ttcctgaccgtcgacggcgcgaagatgtcgaagtcgcgcggcaccttcatcaccgcgcag
agctatatcgacacggggctgaacccggaatggctgcgctactacttcgccgcgaagctg
aacgcgacgatggaagacctcgacctgaacctcgaggatttccaggcgcgcgtgaacagc
gacctggttggcaagtacgtgaacatcgcgagccgcgcggccggcttcctgatcaagcgt
ttcgacggccgcgtgcaggacagcgcgatgaatcacccgctcgtcgcgaagctgcgcgac
gcgatcccgcagatcgccgcgcagtacgaagcgcgcgaatacggccgcgcgctgcgccac
acgatggagctcgcggacgaagtcaacgcgtacgtcgacggcgcgaagccgtgggaactc
gcgaaggatccggccaacgcggtcgcgctgcacgaaacctgcagcgtgagcctcgaggcg
ttccgcctgctgtcgctcgcgctgaagccggtgatgccgcgtgtcgcggaagccgtcgag
gccttcttcgggatcgcgccgctcgcgtgggccgatgcggcgaagccgctgtcgtccgcg
cagccgatccgcgcgtaccagcacctgatgacgcgcgtcgatgcgaagcagatcgaagcg
ctgctcgccgcgaaccgcgactcgctgcaggccgacgcagccggcgcagcggccgccggc
gcggccgccgcgaaggaggcgaagcaggccaaggcgaacgcgaagccggccgccgtcaat
ggcacggacggcgatgcgccgatctcgatcgacgatttcgcgaaagtcgacctgcgcatc
gcgaagatcgtcgcctgccaggccgtcgaaggctcggacaagctgctgcagctcacgctc
gacatcggcgaggaaaagacccgcaacgtgttctccggcatcaagtccgcgtatcagccc
gagcagctggtcggcaagctgacggtgatggtcgcgaacctcgcgccgcgcaagatgaag
ttcgggctgtccgaagggatggtgctcgcggcgtcggcgagcgacgagaaggccgagccg
ggcctgtacatcctcgagccgcacagcggcgcgaagcccggcatgcgcgtgaagtaa

DBGET integrated database retrieval system