KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_2748Help
Entry
DM39_2748         CDS       T03308                                 

Definition
(GenBank) thiJ/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    DM39_2748
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bcen01002]
    DM39_2748
Enzymes [BR:bcen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     DM39_2748
Peptidases [BR:bcen01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   DM39_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI DUF2069
Motif
Other DBs
NCBI-ProteinID: AIO31713
UniProt: A0A088U340
Position
1:2992207..2992890
Genome map
AA seq 227 aa AA seqDB search
MTVHIGFLVFPGVQQLDLTGPHDVLASLPDAAVHLVWKSRDPVASSSGLALAPTCTFADC
PPLDVLCIPGGIGINALLLDAQTIAFVQQRAASVRYLTSVCTGALLLGVAGLLRGRRATT
HWAYHTLLEPLGAVPVHARVVRDGNLITGGGVTAGIDFALTIAAELAGDDEAQAIQLQLE
YAPAPPFDAGSPDTAPASVVQRVTERSAAGLAKRRQIIDEALAAMSR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcatatcggctttctcgtgtttccgggcgtccagcagctcgatctcaccggc
ccgcacgacgtgctcgcgtcgctgcccgacgcagccgttcatctggtgtggaaatcgcgc
gacccggtcgcgtcgagcagcgggctcgcgctcgcaccgacctgtacgttcgccgactgt
ccgccgctcgacgtgctgtgcattccgggcggcatcgggatcaacgcgctgctgctcgat
gcgcagacgatcgcgttcgtgcagcagcgcgcggcgagcgtgcgctatctgacgtcggtc
tgcaccggcgcgctgctgctcggcgtcgcgggcctgctgcgcggacgccgcgcgacgacg
cactgggcgtaccacacgctgctcgaaccgctgggcgcggtgccggtccatgcgcgcgtc
gtgcgcgacggcaacctgatcaccggcggcggcgtgacggccggcatcgatttcgcgctg
acgatcgccgcggaactggccggcgacgacgaagcgcaggcgatccagctgcagctcgaa
tacgcgcccgcaccgccgttcgacgccggctcgccggacaccgcgccggcgtcggtcgtg
cagcgcgtgaccgagcgctcggcggccggcctcgcgaagcgcaggcagatcatcgacgag
gcgctcgcggcgatgtcgcgctga

DBGET integrated database retrieval system