KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_324Help
Entry
DM39_324          CDS       T03308                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00361  Chlorocyclohexane and chlorobenzene degradation
bcen00625  Chloroalkane and chloroalkene degradation
bcen01100  Metabolic pathways
bcen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM39_324
   00361 Chlorocyclohexane and chlorobenzene degradation
    DM39_324
Enzymes [BR:bcen01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DM39_324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AIO32674
UniProt: A0A088UTC0
Position
1:342709..343332
Genome map
AA seq 207 aa AA seqDB search
MTIKAVVFDFGGVLIDWSPDYLYRQLIPDEAERRWFLTHVCAMDWVVRQDGGQTIEDGTN
ELVAKFPEHEALIRAFYARWHEMIGGELAEGVALVERLDAQRMPLFGLTNWSAQTFPYAW
ENFPVLRRFKDIVVSGRVKLVKPDPAIYREMHARIDPHLPGVAPHELVFIDDNAHNAAAA
TALGWHGIHHTSAASTEARLRELGALA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaggcggtggtgttcgatttcggcggcgtgctgatcgactggagccccgat
tacctgtaccggcagctgattcccgacgaggccgagcgccgctggttcctcacgcatgtc
tgcgcgatggactgggtggtgcgtcaggacggcgggcagaccatcgaggacggcacgaac
gaactggtcgcgaagtttcccgagcacgaggcgctgatccgcgcgttctatgcgcgctgg
cacgagatgatcggcggcgaactggcggagggcgtcgcgctcgtcgagcggctcgacgcg
cagcgcatgccgctgttcgggctgaccaactggtccgcgcagacgtttccgtatgcgtgg
gagaacttcccggtgctgcggcgtttcaaggacatcgtcgtgtcgggccgcgtgaagctc
gtgaagcccgatccggcgatctaccgcgagatgcatgcgcggatcgatccgcacctgccg
ggcgtcgcgccgcacgaactcgtgttcatcgatgacaacgcgcacaacgccgcggccgcg
acggcgctcggctggcacggcattcatcatacgagcgcggcatcgaccgaggcgcgcctg
cgcgagctgggcgcgctcgcctga

DBGET integrated database retrieval system