KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_351Help
Entry
DM39_351          CDS       T03308                                 

Gene name
pcaF
Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00280  Valine, leucine and isoleucine degradation
bcen00310  Lysine degradation
bcen00362  Benzoate degradation
bcen00380  Tryptophan metabolism
bcen00620  Pyruvate metabolism
bcen00630  Glyoxylate and dicarboxylate metabolism
bcen00640  Propanoate metabolism
bcen00650  Butanoate metabolism
bcen00900  Terpenoid backbone biosynthesis
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
bcen01120  Microbial metabolism in diverse environments
bcen01130  Biosynthesis of antibiotics
bcen01200  Carbon metabolism
bcen01212  Fatty acid metabolism
bcen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM39_351 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    DM39_351 (pcaF)
   00640 Propanoate metabolism
    DM39_351 (pcaF)
   00650 Butanoate metabolism
    DM39_351 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM39_351 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    DM39_351 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM39_351 (pcaF)
   00310 Lysine degradation
    DM39_351 (pcaF)
   00380 Tryptophan metabolism
    DM39_351 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM39_351 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM39_351 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM39_351 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcen04147]
    DM39_351 (pcaF)
Enzymes [BR:bcen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM39_351 (pcaF)
Exosome [BR:bcen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM39_351 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AIO33857
UniProt: A0A088UBA7
Position
1:complement(369708..370910)
Genome map
AA seq 400 aa AA seqDB search
MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALVERNRDVDWTAIDDVIYGCANQA
GEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAVGTATRAIKAGEARLMIAGGVESM
TRAPFVMGKAASAFARQADIFDTTIGWRFVNPLMKQQYGVDSMPETAENVAVDYDISRAD
QDLFALRSQQKAARAQQDGTLAAEIVPVTIAQKKGDPVVVSRDEHPRETSLEALAKLKGV
VRPDGSVTAGNASGVNDGACALLLANAEAADQYGLRRRARVVGMATAGVEPRVMGIGPAP
ATQKLLRQLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTALYQLERTGGRFALCTMCIGVGQGIALAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcctacatctgcgacgccattcgcacccccatcggccgctacggcggcgcc
ctgaaagacgttcgcgccgacgacctcggcgcggtgccgctcaaggcgctcgtcgagcgc
aatcgcgacgtcgactggacggcaatcgacgacgtgatctacggctgcgcgaaccaggcc
ggcgaagacaatcgcaacgtcgcgcgcatgtcggcgctgctcgccggcctgccgaccgcc
gtgccgggcaccacgctgaaccggctatgcggctcgggcatggacgcggtcggcaccgcc
acgcgtgcgatcaaggcaggcgaagcgcgcctgatgattgcgggcggcgtcgagagcatg
acgcgcgcgccgttcgtgatgggcaaggccgcgagcgcgttcgcacgccaggccgacatc
ttcgatacgacaatcggctggcgcttcgtcaatccgctgatgaagcaacagtacggcgtc
gactcgatgcccgagactgccgagaacgtcgcggtcgactacgatatcagccgcgccgac
caggatctgttcgcgctgcgcagccagcagaaggccgcacgcgcgcagcaggacggcacg
ctcgccgcggagatcgtcccggtcaccattgcgcagaagaaaggcgacccggtcgtcgtg
tcgcgcgacgagcacccgcgcgagacgtcgctcgaagcgctggcgaagctgaagggcgtg
gtacgcccggacggctcggtgacggccggcaacgcgtcgggcgtcaacgacggcgcatgc
gcgctgctgctcgccaatgccgaagcggccgaccagtacggcctgcggcggcgcgcgcgc
gtggtcggcatggcgaccgccggcgtcgagccgcgcgtgatgggcatcggccccgcgccg
gccacgcagaagctgctgcgccagctcggcatgacgatcgatcagttcgacgtgatcgag
ctgaacgaggcgttcgcgtcgcagggcctcgcggtgctgcgcatgctcggcgtcgccgac
gacgatccgcgcgtgaacccgaacggcggtgcgatcgcgctcggccacccgctcggcgcg
tcgggcgcacggctcgtgaccacggccctgtaccagctcgaacgcaccggcggccgcttc
gcgctctgtacgatgtgcatcggcgtcggccagggcatcgcgctggccatcgagcgcgta
tag

DBGET integrated database retrieval system