KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_3679Help
Entry
DM39_3679         CDS       T03308                                 

Definition
(GenBank) hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00460  Cyanoamino acid metabolism
bcen00500  Starch and sucrose metabolism
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DM39_3679
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    DM39_3679
Enzymes [BR:bcen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     DM39_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like Toprim_3
Motif
Other DBs
NCBI-ProteinID: AIO34598
UniProt: A0A088UBG9
Position
2:352261..354462
Genome map
AA seq 733 aa AA seqDB search
MRDTLWPAAVLAATLCANVHAGTADFTPSTDSIDAFASAAAQRRADLLVRKMTLDEKLQF
IHSKYEMSSVPGGGAGYIQGVPRLGIPDLNMVDSATGSGSTSQPSTTFPATIAVAASWDR
RLSYDYGKQVAIQLRAQGFGMGLGGGTNLAREPRGGRLFEYLGEDPLLAGDLLAERTLAT
QRQKVIATIKHYAGNEQEHGRMGGNSQIDERTLRELYLLPFEIAAKRGQPGSVMCSYNRL
NGDYACENTHLLNDVLKNEWGFQGQVQSDWGATHSTAAAINAGLDEEEDVGPTVYLTPAA
VKQAIANGSVSTARLDDMVRRKLAVMIRVGVMDDPARGGGTIDFAAANRFAQSVAEQSIV
LLKNDGNQLPLAASALSRIAVIGGHADAAVMSGGGSGNTRDPVTGSFAGCGGLTFGSSSG
CSWWRNPWLKVDVPIVAAIRALAPAAQVTFAGNSDQQSPFRAYTQQEIDQAAALAGRSDV
AIVVVAQPAGEDFGDLQSLSLANPSNQDALVEAVARANPHTIVVVQSGNPVLMPWKDQVS
AIVEAWYPGEGGGKAIANVLFGAVNPSGRLPVTFPARDQDTPTWGANGTFDNDPVYAEKL
DMGYRWYDARNIKPMFEFGYGLSYTHFAYSGLSVSRQGDGSLSVSFTVRNDGRVAGTDTP
QVYLGVPYKDEPPKRLVGWEKIRLNPGDARHVRLTVSPRMQSVWDTSRNGWRYVPGATVY
VGASSRDIRLQGR
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacacactctggccggccgccgtgctggcagcgaccctctgcgccaatgtccat
gcgggcacggccgatttcacgccatccaccgacagcatcgatgcattcgcgtcggccgcc
gcgcagcggcgcgccgatctgctcgtgcgcaagatgacgctcgacgagaagctgcagttc
attcattcgaaatacgaaatgtcgagcgtgccgggcggcggcgccggctatatccagggc
gtgccgaggctcggcattcccgacctgaacatggtcgattcggcgaccggctccggcagc
acgtcgcaacccagcacgacctttccggcgacgatcgcggtcgccgcgagctgggaccgg
cgcctgtcgtacgactacggcaagcaggtcgcgatccagttgcgcgcgcaaggattcggg
atggggcttggcggcggcaccaacctcgcgcgcgagccgcgcggcggccggctgttcgag
tatctcggcgaggatccgctgctcgccggcgacctgctcgcggagcgcacgctggccacg
cagcgtcagaaggtcatcgcgaccatcaagcactacgcgggcaacgagcaggagcacggc
cggatgggcggcaactcgcagatcgacgagcgcacgctgcgcgaactgtacctgctgccg
ttcgagatcgccgcgaagcgcgggcagcccggcagcgtgatgtgcagctacaaccggctg
aacggcgactatgcgtgcgagaacacgcacctgctcaacgacgtgctgaagaacgaatgg
gggttccagggccaggtgcagtccgactggggcgcaacgcacagcacggccgccgcgatc
aacgccgggctcgacgaggaagaggacgtcgggccgaccgtgtacctgacgccggccgcc
gtcaagcaggcgatcgcgaacggctcggtgtcgaccgcgcgcctggacgacatggtgcgg
cgcaagctggcggtgatgattcgcgtcggcgtgatggacgatccggcccgcggcggcggc
acgatcgatttcgcggcggcgaaccgcttcgcacagtccgtcgccgaacagtcgatcgtg
ctgctgaagaacgacggcaaccagttgccgctcgccgcatcggcgctgtcgcgcatcgcg
gtgatcggcggccacgcggacgcggccgtgatgtccggcggcggctccggcaatacgcgc
gacccggtcaccggatcgttcgccggctgcggcggcctgacgttcggatcgtcgagcggc
tgcagctggtggcgcaatccgtggctgaaggtcgacgtgccgatcgtcgcggcgatccgt
gcgctcgcgccggccgcgcaggtcacgttcgcgggcaacagcgaccagcagtcgccgttt
cgcgcctacacgcagcaggagatcgaccaggcggcggcgctcgccggccgctcggacgtc
gcgatcgtcgtggtcgcgcagccggccggcgaggatttcggcgatctgcaaagcctgagc
ctcgcgaacccgtcgaaccaggatgcgctggtcgaagcggtcgcgcgcgcgaatccgcat
acgatcgtcgtcgtgcagagcggcaatccggtgctgatgccgtggaaggaccaggtatcc
gcgatcgtcgaggcgtggtatccgggcgaaggcggcggcaaggcgatcgcgaacgtgctg
ttcggcgcggtcaatccgtccggcaggctgcccgtgaccttcccggcccgcgaccaggac
acgccgacctggggtgcgaacggcacgttcgacaacgatcccgtctatgcggaaaagctc
gacatgggctatcgctggtacgacgcgcgcaacatcaagccgatgttcgaattcggctac
gggctgtcgtatacgcatttcgcgtattcggggctgtcggtgtcgcggcagggggacggc
tcgctgagcgtgtcgtttaccgtgcgcaacgacggccgcgtcgccggcacggacacgccg
caggtctatctcggcgtgccgtataaggacgaaccgccgaagcggctggttggctgggag
aagatccggctcaatccgggcgacgcgcggcacgttcgcctgaccgtgtcgccgcggatg
cagagcgtctgggatacgtcgcgcaacggctggcgctatgtgccgggcgccacggtatat
gtcggcgcgtcgtcgcgcgatatccgcctgcagggacgctga

DBGET integrated database retrieval system