KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_3691Help
Entry
DM39_3691         CDS       T03308                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00430  Taurine and hypotaurine metabolism
bcen00460  Cyanoamino acid metabolism
bcen00480  Glutathione metabolism
bcen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DM39_3691 (ggt)
   00460 Cyanoamino acid metabolism
    DM39_3691 (ggt)
   00480 Glutathione metabolism
    DM39_3691 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcen01002]
    DM39_3691 (ggt)
Enzymes [BR:bcen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     DM39_3691 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     DM39_3691 (ggt)
Peptidases and inhibitors [BR:bcen01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   DM39_3691 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIO35598
UniProt: A0A088UEA8
Position
2:complement(365910..367631)
Genome map
AA seq 573 aa AA seqDB search
MTTLNRFKSSAVVLATAAGIGFLPNAPVYAKGPQPAVLTSSAVAVADKYSADAAERIFKE
GGNAIDAAVAIAFTLAVTYPEAGNIGGGGFMTIYKDGKPYFIDYRERAPLAATKDMYLDK
DGNVIKGMSLYGPRAAGVPGTVAGMWEAQKRFGKLKWKQVLAPAIHYARDGFIVDEQLAQ
RGVDASKEFGGKTNFDKYFSGLKAGANFKQPDLADVLTRIANNGAEGFYKGKTAELIAAS
MKTGDGNGLITTEDLAQYRAVWRQPVQAKWNGYDVITAPPPSSGGIGLVQLLKMKADLKQ
DFEGVPLNSPQYIHLIAEIEKRVFADRAQYLGDPDFYKVPVAQLTDDAYIAKRAAEVNPK
QPSDTKSVQPGLGTTMPEKAETTHFSVVDKWGNAVSNTYTINGYFGSGVVADGTGIVLND
EMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSSMSPTIMTKDGKVSLVIGTPGGSRIFT
SIFQVINNVYDFKMPLKEAVGAMRFHHQLLPPNTIFWEPYHPIEGELAKQIEARGYTLKG
QDFSGDIQVIKIDGNTPEAVADPRGRGVTRIIR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgactacgttgaatcgcttcaaatcatccgctgtcgtgcttgcgacggcggccggcatc
ggtttcctgccgaacgcgcccgtctatgcgaaagggccgcagccggcggtcctgacgagt
tccgcggtcgcggtggccgacaaatacagcgcggatgccgcggagcggatcttcaaggaa
ggcggcaacgcgatcgacgcggccgtcgcgatcgcgttcacgctcgccgtcacgtacccg
gaagccggcaatatcggcggcggcggcttcatgacgatctacaaggacggcaagccttac
ttcatcgactaccgcgagcgcgcgccgctcgccgcgaccaaggacatgtacctcgacaag
gacggcaacgtcatcaagggcatgagcctctacggcccgcgcgcggccggcgtgccgggc
acggtcgcaggcatgtgggaggcgcagaagcgcttcggcaagctgaagtggaagcaggtg
ctcgcgccggcgatccactatgcacgcgacggcttcatcgtcgacgagcagcttgcgcag
cgcggcgtcgacgcgtcgaaggagttcggcggcaagaccaacttcgacaagtacttctcc
ggcctgaaggccggcgcgaacttcaagcagcccgatctcgccgacgtgctgacgcgcatc
gcgaacaacggcgcggaaggcttctacaagggcaagacggccgagttgatcgccgcgtcg
atgaagaccggcgacggcaacgggctgatcaccaccgaggatctcgcgcagtaccgcgcg
gtctggcgccagccggtgcaggcgaaatggaacggctatgacgtgatcaccgcgccgccc
ccgagttcgggcggcatcggcctcgtgcagctgctgaagatgaaggccgacctcaagcag
gatttcgaaggcgtgccgctgaattcgccgcagtacatccacctgatcgccgaaatcgag
aagcgcgtgttcgccgatcgtgcgcagtatctcggcgaccccgacttctacaaggtgccg
gtcgcgcagctgaccgacgacgcctatatcgcgaagcgcgcggccgaggtaaacccgaag
cagccatcggacaccaagagcgtgcagccgggcctcggcacgacgatgccggagaaggcc
gagacgacgcacttctcggtcgtcgacaagtggggcaacgcggtgtcgaacacctacacg
atcaacggctatttcggttcgggcgtggtcgccgacggcaccggcatcgtgctgaacgac
gagatggacgacttctccgcgaagccgggcgtcgccaacatgttcggcgtggtcggcagc
gacgcgaacgcgatcgaaccgaagaagcggccgctgtcgtcgatgtcgccgaccatcatg
acgaaggacggcaaggtgtcgctcgtgatcggcacgccgggcggctcgcggatcttcacg
tcgatcttccaggtgatcaacaacgtgtacgacttcaagatgccgttgaaggaggcagtc
ggcgcgatgcgcttccatcaccaactgctgccgccgaacacgatcttctgggagccgtac
cacccgatcgagggcgagctcgccaagcagatcgaggcgcgcggctatacgctgaagggg
caggatttcagcggcgacatccaggtgatcaagatcgacggcaatacgccggaagcggtg
gccgatccgcgcggacgcggcgtcacgcggatcatccgctga

DBGET integrated database retrieval system