KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4410Help
Entry
DM39_4410         CDS       T03308                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM39_4410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcen02000]
    DM39_4410
Transporters [BR:bcen02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DM39_4410
   Histidine transporter
    DM39_4410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1440
Motif
Other DBs
NCBI-ProteinID: AIO34424
UniProt: A0A088UYK7
Position
2:complement(1183008..1183697)
Genome map
AA seq 229 aa AA seqDB search
MIFQGFGPLLWAGTVETVKLAVLSLAASLILGLAGAAAKLSTNRVLKSLGTFYTTLIRAV
PDLVLMLLLFYGIQILLNNATDLLGWDQIDIDPFVAGVVTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMNGWRVFHRILFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
SQDAGKSTLDFFFFTLAAGAIYLAITTVSNLVLHHLEKRYSAGVRRLAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgattttccaaggatttggcccgctgctgtgggccggcacggtcgaaaccgtgaagctc
gcggtgctgtcgctcgccgcgtcgctgatactgggcctcgccggcgcggccgcgaagctg
tcgacgaaccgcgtgctcaagtcgctcggcacgttctacacgacgctgatccgcgcggtg
cccgacctcgtgctgatgctgctgctgttctacgggatccagatcctgctgaacaacgcg
accgacctgctcggctgggaccagatcgacatcgacccgttcgtggccggcgtcgtgacg
ctcggcttcatctacggcgcgtacttcaccgagacctttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaagcgggcttcgcatacgggatgaacggctggcgcgtgtttcac
cgcatcctgttcccgcagatgatgcgctttgcattgccgggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctggtgtcgatcatcggcctggccgacgtcgtgaaggcg
tcgcaggacgcgggcaagagcacgctcgatttcttcttcttcacgctcgcggccggtgcg
atctacctcgcgatcacgacggtgtcgaacctcgtgctgcaccatctcgagaagcgttac
tcggccggcgtccggaggcttgcactgtga

DBGET integrated database retrieval system