KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_5590Help
Entry
DM39_5590         CDS       T03308                                 

Definition
(GenBank) 3-Oxoacyl-[acyl-carrier-(ACP)] synthase III family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00071  Fatty acid degradation
bcen00072  Synthesis and degradation of ketone bodies
bcen00280  Valine, leucine and isoleucine degradation
bcen00310  Lysine degradation
bcen00362  Benzoate degradation
bcen00380  Tryptophan metabolism
bcen00620  Pyruvate metabolism
bcen00630  Glyoxylate and dicarboxylate metabolism
bcen00640  Propanoate metabolism
bcen00650  Butanoate metabolism
bcen00900  Terpenoid backbone biosynthesis
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
bcen01120  Microbial metabolism in diverse environments
bcen01130  Biosynthesis of antibiotics
bcen01200  Carbon metabolism
bcen01212  Fatty acid metabolism
bcen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcen00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM39_5590
   00630 Glyoxylate and dicarboxylate metabolism
    DM39_5590
   00640 Propanoate metabolism
    DM39_5590
   00650 Butanoate metabolism
    DM39_5590
  Lipid metabolism
   00071 Fatty acid degradation
    DM39_5590
   00072 Synthesis and degradation of ketone bodies
    DM39_5590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM39_5590
   00310 Lysine degradation
    DM39_5590
   00380 Tryptophan metabolism
    DM39_5590
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM39_5590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM39_5590
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DM39_5590
Enzymes [BR:bcen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM39_5590
Exosome [BR:bcen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM39_5590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIO35613
UniProt: A0A088UEB7
Position
2:2487330..2488496
Genome map
AA seq 388 aa AA seqDB search
MTVAIVGWGHLPFGRLDSLSLEDLIVGAGRAALGDAGVPADSVDGIWLGNLNGGFVPDIF
AAPLALNCDAGLRWKPAVRVENACASGSAAVYAACDAIEAGRARIALVIGAEKMTSVSGA
EVTRILGNCGYSGEAGHPPGGFPGIFAEVARDYFDQYGDHSATLAAIAAKNHANGVANPW
AHMRRDLGFEFCNTVSEKNPLIAPPLRKTDCSLVSDGAAALVLVAEDLAADFAKAVSIRA
RVQVNDYLPLAQRRAIEFTGPKRAWKGALQDAGCTIDDLSFAEVHDCFTIAELLAYEAMG
LAPEGQGHRVIEDGTVARGGRFPVNASGGLKAKGHPIGATGVSMHVIAAMQLAGEAGGMQ
IPGPTLGGVFNMGGAAVASYVSILERSR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcaatcgtgggttgggggcacctgccatttggccgacttgactccctgagc
ctggaagacctgattgtgggcgctggccgcgcggcgctcggcgatgcaggtgttccggca
gattccgtggatggtatctggctgggcaatctgaatggcggattcgtgcccgacatcttt
gccgcgccgcttgcgctgaactgcgatgccggcctgcggtggaaaccggcggttcgcgtc
gaaaacgcatgtgcatcgggctcggcggcagtctatgcagcatgtgatgcgatcgaggcg
gggcgagcacgcatcgccctggtgatcggggctgaaaagatgacgtcggtatccggcgcc
gaggtgacgcggattctcggaaattgcggatactcgggcgaggcgggccaccctccaggc
ggctttcccggcatatttgcggaagtcgcccgggactatttcgaccagtacggtgatcac
tccgcgacgctcgcagccatcgccgcgaaaaaccatgcgaacggtgtcgccaatccctgg
gcgcatatgcggcgggatctcggcttcgagttttgcaacaccgtctcggagaagaacccg
ctgattgcgccgccgttacgcaaaacggactgctcgcttgtctctgacggcgcggctgcg
ctggttctggttgcggaagacctggctgcggatttcgcgaaggctgtctcgattcgggcc
cgcgtgcaggtcaacgactatcttcccctggcgcagcgccgggcgatcgagttcaccggc
ccgaagcgtgcctggaaaggcgcgctgcaggacgccggctgtacgatcgacgatctttcc
ttcgccgaagtgcacgattgcttcacgatcgcggaactgctcgcctatgaggcgatgggg
ctcgctccagagggacaagggcatcgtgtgatcgaggacggaaccgtcgcccgcgggggg
cgtttcccggtcaatgcctcgggcggcctcaaggcaaagggccatccgatcggagccacg
ggtgtttcgatgcacgtcatcgccgcgatgcagctggcaggcgaggctggcgggatgcag
attcccggtcccacgctgggcggcgtgttcaacatggggggcgctgcggtggcgagttac
gtcagcattctggagcgcagtcgatga

DBGET integrated database retrieval system