KEGG   Burkholderia cenocepacia H111: I35_0885Help
Entry
I35_0885          CDS       T03804                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00970  Aminoacyl-tRNA biosynthesis
bceo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I35_0885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bceo03029]
    I35_0885
Enzymes [BR:bceo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     I35_0885
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     I35_0885
Mitochondrial biogenesis [BR:bceo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    I35_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CDN59408
Position
1:complement(951814..953190)
Genome map
AA seq 458 aa AA seqDB search
MTTFTPFPPLAQLAADLAAGRTTSRALVDTALDRIADPAGQGAVVFTEVDADNARAAADA
HDRLRAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLDGAPAARTDAVAVARLKRAGA
VLVGRTNMSEFAFSGLGLNPHFGNPRSPYHRDVPGDARISGGSSSGAAASVADGMAAVAL
GTDTGGSIRIPAALCGLTGFKPTASRIPTQGGVPLSTTLDSFGPIGLTVACCALVDRMLA
GLEPHVPAARPLEGVRLGVLTNYVTDGVDADVAAALDTALKHLEAAGAIVTEVRFPALDR
LPEINRFGFSPIEAYAWHRPLLATHRDQYDPRVLTRILKGEPASAADYLDLLAARAAMLD
EAAHTVWSRFDALVAPTVPVVPPRIAELETDDDAFTRTNALILRNPSAFNFLDACGLSLP
CHPRDAAPVGLMLAAAPHRDDALLAIGQSVEAVLNTIR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttcacgccgttccccccgctcgcccagctcgccgccgacctcgccgccggc
cggaccacgagccgcgcgctcgtcgacaccgcgctcgaccggatcgccgatccggccggc
cagggcgcggtcgtcttcaccgaagtcgatgccgacaacgcccgcgcggccgccgacgcg
cacgaccggctgcgcgccgcgggcaccgtgctgtcgccgctcgcgggcattccggtatcg
gtcaaggacctgttcgacgtcgcgggccaggtgacgcgcgcgggctcgcgcgtgctcgac
ggcgcaccggccgcgcgcaccgatgcggtcgccgtcgcgcggctcaagcgcgcgggcgcg
gtgctggtcggccgcaccaacatgagcgaattcgcgttctcggggctcgggctgaatccg
cacttcggcaatccgcgctcgccgtaccaccgcgacgtgccgggcgacgcgcggatttcg
ggcggctcgtcgtcgggggcggccgcgtcggtcgcagacgggatggccgccgtcgcactc
ggcaccgacaccggcggctcgatccgcatcccggccgcgctgtgcgggctcacgggcttc
aagccgaccgcgagccggatcccgacgcaaggcggcgtgccgctgtcgacgacgctcgac
tcgttcggcccgatcggcctcacggtcgcgtgctgcgcgctcgtcgaccggatgctggcg
gggctcgagccgcacgtgccggccgcccggccgctcgaaggcgtacggctcggcgtgctg
acgaactacgtgacggacggcgtcgatgccgacgtcgcggccgcgctcgacaccgcgctc
aagcatctggaagccgccggcgcgatcgtcaccgaagtgcgcttccccgcgctcgaccgg
ctgccggagatcaaccgtttcggcttctcgccgatcgaggcgtacgcgtggcatcgtccg
ctgctcgccacgcatcgcgaccagtacgacccgcgcgtgctgacgcggatcctgaagggc
gaacccgcgagcgccgccgactatctcgacctgctcgccgcgcgtgccgcgatgctcgac
gaagccgcgcacacggtctggtcgcgcttcgacgcgctcgtcgcgccgacggtgccggtc
gtgccgccgcgcatcgccgaactcgaaacggacgacgacgcgttcacgcgcaccaacgcg
ctgatcctgcgcaacccgagcgcgttcaacttcctcgatgcgtgcgggctgtcgctgccg
tgccatccgcgcgacgcggcgccggtcggcctgatgctcgcggcggcgccgcatcgcgac
gacgcgctgctcgcgatcggccagtcggtcgaggccgtgctgaacacgatccgctga

DBGET integrated database retrieval system