KEGG   Burkholderia cenocepacia H111: I35_4430Help
Entry
I35_4430          CDS       T03804                                 

Definition
(GenBank) Indoleacetamide hydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00330  Arginine and proline metabolism
bceo00360  Phenylalanine metabolism
bceo00380  Tryptophan metabolism
bceo00627  Aminobenzoate degradation
bceo00643  Styrene degradation
bceo01100  Metabolic pathways
bceo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    I35_4430
   00360 Phenylalanine metabolism
    I35_4430
   00380 Tryptophan metabolism
    I35_4430
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I35_4430
   00643 Styrene degradation
    I35_4430
Enzymes [BR:bceo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     I35_4430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CDN62266
Position
2:492620..494020
Genome map
AA seq 466 aa AA seqDB search
MTELWQLSATELAKRVRRRDVSAREVADAVLDRLDAVNPAINAVVEHRPDDVRQQADEVD
RAIARGDDPGPLAGVPVTVKINVDQAGFATTNGTRLQRNLVAPADSPVVANIRKAGGVLL
GRTNSPTFALRWFTANLVHGHTRNPRNASLTPGGSSGGAAAAVAAGIGPLAVGTDIGGSV
RYPAYACGVHGIRPSLGRVPAFNASSPERAIGAQLMSTAGPIARTIDDLSLALRAFSAPD
PRDPWHVAVPFDGREVPKRAALCVRPRGLEVVPEVEAALRDAARRLVDAGWTVDEIDDTP
PMREAALLQEQLWLGDGFDALANAVAQDGDPGAAAVIAAVRGKVRDLPADVISRALVRRT
TLTRAWRLFLDDYAVLLLPVSAELPFPDDLDRQGPDGFERVWEAQLTLRALPAMGLPGLA
VTTSIVNGVPVGVQVVATHHREDLCLLAGRDIEARGVPIVPVDPVV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactctggcaactgtccgcgaccgaactcgcgaaacgcgtgcggcggcgcgac
gtatccgcgcgcgaagtggcggacgcggtgctcgatcgtctcgatgccgtgaatccggcg
atcaacgcggtggtcgaacaccgtcccgacgacgtgcggcagcaggccgacgaagtcgat
cgcgcgatcgcgcgcggcgacgatccggggccgctcgcgggcgtccccgtcaccgtgaag
atcaacgtcgatcaggccggctttgcgacgaccaacggcacgcgtttgcagcgcaatctg
gtcgcgcccgccgacagcccggtggtcgcgaacatccggaaggccggcggggtgctgctc
ggccgcaccaattccccgacgttcgcattgcgctggttcacggcgaatctcgtgcatggc
cacacgcgcaatccgcgcaatgcgtcgctgacgccgggcggatcgagcggtggcgcggcg
gcggccgtggctgccgggatcggcccgctcgcggtcggcaccgacatcggcggctcggtg
cgctacccggcctatgcatgcggcgtacacgggatccggccgtcgctcggccgcgtgccg
gcattcaatgcatcgtcgcccgagcgggcgatcggcgcgcaactgatgtcgacggccggg
ccgatcgcgcgcacgatcgacgatctctcgctcgcgctacgcgccttctccgcgccggac
ccgcgcgatccgtggcacgtcgcggtgccgttcgacgggcgcgaggtgccgaagcgcgcg
gcgctgtgcgtgcgtccgcgcggcctggaggtcgtgcccgaagtcgaggccgcgctgcgc
gatgccgcgcgccggctggtcgatgccggctggaccgtcgacgagatcgacgatacgccg
ccgatgcgcgaggccgcgctgctgcaggagcagctgtggctcggcgatggtttcgatgcg
ctggcgaacgccgtggcgcaagacggcgatccgggcgcggccgcggtgatcgccgccgtg
cgcggcaaggtgcgcgacctgccggccgacgtgatcagccgcgcgctggtccggcgtacc
acgctgacgcgagcgtggcggctgtttctcgacgactatgcggtgctgctgttgcccgtt
tcggcggaactgccgttccccgacgatctcgaccggcaagggccggacggcttcgagcgc
gtgtgggaagcgcagctcacgttgcgcgcgctgcccgcgatggggctgccggggctggcc
gttacgacatcgatcgtgaacggcgtgccggtgggcgtgcaggtggtggccacgcatcat
cgcgaggatctgtgtctgcttgccgggcgcgatattgaagcgcgcggggtgccgattgtg
ccggtcgatccagtggtatga

DBGET integrated database retrieval system