KEGG   Burkholderia cenocepacia H111: I35_5469Help
Entry
I35_5469          CDS       T03804                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00984  Steroid degradation
bceo01100  Metabolic pathways
bceo01120  Microbial metabolism in diverse environments
bceo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    I35_5469
Enzymes [BR:bceo01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     I35_5469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Ndr Abhydrolase_3 Abhydrolase_5 Thioesterase
Motif
Other DBs
NCBI-ProteinID: CDN63305
Position
2:complement(1657458..1658294)
Genome map
AA seq 278 aa AA seqDB search
MTTPTTPPAGIFTDVPGGMRLHHFEAGEGRPVVFIHGSGPGASGFSNFKHNYPAFAAAGH
RAIVVDLPGYGQSSKPSDVAYTLDFFVGALHAQLAALGIGPAVLLGNSLGGAIALKYALD
YPDEVDGLIMMAPGGVEDRDTYFRMEGIQRMVKLFTHRQMNDDTMRELLTLLVHDPAIVT
DALVAERMKVCVEQPTEVLSTMSVPNLTAALGDLRSPVLGFWGTDDRFNPVGGALTFLER
CRDARFVLMNRCGHWVMVEHADYFNRECLDFLAARNTR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccccacgacgccgccggccggcatcttcaccgacgtaccgggcggcatgcgc
ctgcatcatttcgaggcgggcgagggccggccggtggtgttcattcacggcagcgggccg
ggcgccagcggcttcagtaacttcaagcacaactatccggcgttcgcggcggccggccat
cgcgcgatcgtcgtcgacctgcccggctacgggcagtcgtcgaagccgtccgacgtcgcc
tatacgctcgatttcttcgtcggtgcgctgcatgcgcaactcgccgcgctcgggatcggg
ccggccgtcctgctcggcaattcgctcggcggcgcgatcgcgctgaaatacgcactcgac
tacccggacgaagtggacgggctgatcatgatggcgcccggcggcgtcgaggatcgcgac
acctatttccggatggaagggattcagcggatggtgaagctgttcacccatcgccagatg
aatgacgacacgatgcgcgaactgctgacgctgctcgtgcacgatccggcgatcgtcacc
gacgcgctcgtcgccgagcggatgaaggtatgcgtcgagcagccgaccgaagtgctgtcg
acgatgagcgtgccgaacctgaccgcggcgctcggcgatctgcgcagcccggtgctcggt
ttctggggtacggacgatcgcttcaatccggtcggcggcgcgctgaccttcctcgaacgc
tgccgcgatgcgcgcttcgtgctgatgaaccgctgcggccattgggtgatggtggagcac
gccgattatttcaatcgggaatgcctcgattttcttgcggcgcggaatacgcgataa

DBGET integrated database retrieval system