KEGG   Burkholderia cenocepacia H111: I35_5475Help
Entry
I35_5475          CDS       T03804                                 

Gene name
bphI
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00362  Benzoate degradation
bceo00621  Dioxin degradation
bceo00622  Xylene degradation
bceo01100  Metabolic pathways
bceo01120  Microbial metabolism in diverse environments
bceo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I35_5475 (bphI)
   00622 Xylene degradation
    I35_5475 (bphI)
   00621 Dioxin degradation
    I35_5475 (bphI)
Enzymes [BR:bceo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     I35_5475 (bphI)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     I35_5475 (bphI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: CDN63311
Position
2:1664168..1665199
Genome map
AA seq 343 aa AA seqDB search
MSLAGKKITVHDMSLRDGMHPKRHQITLDQMRDIARGLDAAGVPLIEVTHGDGLGGASVN
YGFPAHTDEAYLSAVIPELKQARVSALLLPGIGTVEHLRMAHALGVGTIRVATHCTEADV
SEQHIGLARTLGLDTVGFLMMAHMSSPAQLVVQAKLMESYGANCIYITDSAGHMLPDDVT
ARIGQVRDALKPETELGFHGHHNLAMGVANSVAAVAAGANRIDAAAAGLGAGAGNTPMEV
FVAVCDRMGIETGVDVFAISDVAEDLVVPIMDAPIRLDRDALTLGYAGVYSSFLLFAKRA
EAKYGIPARDILVELGRQRLVGGQEDMIEDAALTMVRAREVAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttgcaggcaagaagatcaccgtccacgacatgtcgctgcgcgacgggatgcac
ccgaagcgccaccagatcacgctcgaccagatgcgcgacatcgcgcgcgggctcgacgcg
gccggcgtgccgctgatcgaggtcacgcacggcgacggcctcggcggcgcgtcggtcaac
tacgggtttcccgcgcacaccgacgaggcgtacctgagcgccgtgattccggagctgaaa
caggcccgggtgtccgcgctgctgctgcccggcatcggcaccgtcgagcacctgcgcatg
gcgcacgcactcggcgtcggcacgatccgcgtcgcgacgcactgcaccgaggccgacgtg
tccgagcagcatatcggcctcgcacgcacgctcgggctcgacacggtcggcttcctgatg
atggcgcacatgtcgtcgccggcacagctcgtcgtacaggcgaagctgatggagtcgtac
ggcgcgaactgcatctacatcaccgattcggccggccacatgctgcccgacgacgtgacc
gcgcgaatcggccaggtgcgcgacgcgctgaagccggagacggagctcggcttccacggc
caccacaacctcgcgatgggcgtcgcaaattcggtcgcggcggtcgccgccggcgcgaac
cggatcgacgcggcggcggccggcctcggcgccggcgcgggcaacacgccgatggaagtg
ttcgtcgcggtgtgcgaccggatggggatcgaaacgggcgtcgacgtattcgcgatttcc
gacgtcgccgaggatctcgtcgtgccgatcatggatgcgccgatccgtctcgaccgcgac
gcgctgacgctcggctatgcgggcgtctactcgtcgttcctgctgttcgcgaagcgtgcg
gaagcgaagtacgggattccggcgcgcgacatcctcgtcgagctgggccgtcagcggctc
gtcggcgggcaagaggacatgatcgaggacgcggcgctgacgatggtgcgggcgcgggag
gtggcggcgtag

DBGET integrated database retrieval system