KEGG   Burkholderia cenocepacia H111: I35_5943Help
Entry
I35_5943          CDS       T03804                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00071  Fatty acid degradation
bceo00072  Synthesis and degradation of ketone bodies
bceo00280  Valine, leucine and isoleucine degradation
bceo00310  Lysine degradation
bceo00362  Benzoate degradation
bceo00380  Tryptophan metabolism
bceo00620  Pyruvate metabolism
bceo00630  Glyoxylate and dicarboxylate metabolism
bceo00640  Propanoate metabolism
bceo00650  Butanoate metabolism
bceo00900  Terpenoid backbone biosynthesis
bceo01100  Metabolic pathways
bceo01110  Biosynthesis of secondary metabolites
bceo01120  Microbial metabolism in diverse environments
bceo01130  Biosynthesis of antibiotics
bceo01200  Carbon metabolism
bceo01212  Fatty acid metabolism
bceo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I35_5943
   00630 Glyoxylate and dicarboxylate metabolism
    I35_5943
   00640 Propanoate metabolism
    I35_5943
   00650 Butanoate metabolism
    I35_5943
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I35_5943
   00072 Synthesis and degradation of ketone bodies
    I35_5943
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I35_5943
   00310 Lysine degradation
    I35_5943
   00380 Tryptophan metabolism
    I35_5943
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I35_5943
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I35_5943
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I35_5943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bceo04147]
    I35_5943
Enzymes [BR:bceo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I35_5943
Exosome [BR:bceo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I35_5943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt UPF0731
Motif
Other DBs
NCBI-ProteinID: CDN63779
Position
2:2193146..2194330
Genome map
AA seq 394 aa AA seqDB search
MIDAVIVSTARTPIGKAYRGAFNLTHSPTLLGHAIRHAVLRAGIEPDRIEDAVIGSVLNA
GTAGGNIARHGVLAAGLPASVAAQTLDRQCASGLMAIATAAKQIMCDGMQVVVAGGQENI
SAVQTRYFEWTRADEDPNVLAAQPAAYMPMLETAEFVSRKYGISRDVQDQYALDSQLRTA
AAQAAGRFSSEIVPITTQKLVVDKATGTTSRHEVTLKQDEGNRPGTTLESLATLAPVIDG
GVVTAGNASQLSDGASACVLMNGKTAEQIGATPLGIYRGMTVVGNAPEEMGIGPIYAIPK
LLELHGLKTDDIGLWELNEAFACQALYCREKLGIDPARYNVNGGSISIGHPYGMTGARMV
GHALIEGKRRGARYVVVSMCVGGGMGAAGLFEVA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgctgtcatcgtttccaccgcacgtacgcccatcggaaaggcctatcgtggg
gcattcaacctcacgcactcgcctaccctgctcgggcacgcaatccggcacgcggtactg
cgtgccggcattgagccggatcgtatcgaagacgccgtgatcggttcggtactcaacgcc
gggaccgccggcggcaatatcgcccgacacggcgtgctggcggccggattgcctgccagc
gtcgctgcgcaaacactcgaccggcaatgtgcgtccggcctgatggcgatcgcgacggcc
gccaagcagatcatgtgcgacgggatgcaggttgtcgtggcgggcggccaggaaaacatc
tcggcggtacaaacgcgctacttcgagtggacccgcgccgacgaggaccccaatgtgctg
gccgcgcaacccgcggcctacatgccgatgctcgagaccgccgagttcgtttcccgcaag
tacgggatctcgcgggacgtccaggatcagtacgcactcgattcccagctccgcactgcc
gccgcacaagccgccggccgcttctcgagcgaaatcgttccgatcacgacacagaagctg
gtcgtcgacaaagcgaccggcacgacgtcgagacatgaggtcacgctcaagcaggacgag
ggaaatcgtcccggcacgacgctcgaatcgctggccacgctcgcaccggtaatcgacggc
ggcgttgtgacggcgggtaacgcgagccagctttcggacggtgcaagcgcctgcgtcctg
atgaacggaaaaaccgccgagcagatcggggccacccctctcggcatctatcggggcatg
accgtcgtcggcaatgcgccggaggagatgggcatcggtccgatctatgcgatccccaag
cttctggagcttcatggcctcaaaaccgacgacatcggcttatgggagctcaatgaggcg
tttgcctgccaagcgctgtactgccgtgagaagctgggaatcgatcccgcgcgatacaac
gtcaacggcggcagcatttctatcggccatccgtacgggatgaccggcgcacgcatggtc
ggtcatgccctgatcgaaggcaaaagacgcggtgcacgctacgtcgttgtttcgatgtgt
gtaggcggcggaatgggtgcggccggcttgttcgaagtcgcttga

DBGET integrated database retrieval system