KEGG   Burkholderia cenocepacia H111: I35_5951Help
Entry
I35_5951          CDS       T03804                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00010  Glycolysis / Gluconeogenesis
bceo00053  Ascorbate and aldarate metabolism
bceo00071  Fatty acid degradation
bceo00280  Valine, leucine and isoleucine degradation
bceo00310  Lysine degradation
bceo00330  Arginine and proline metabolism
bceo00340  Histidine metabolism
bceo00380  Tryptophan metabolism
bceo00410  beta-Alanine metabolism
bceo00561  Glycerolipid metabolism
bceo00620  Pyruvate metabolism
bceo00625  Chloroalkane and chloroalkene degradation
bceo00903  Limonene and pinene degradation
bceo01100  Metabolic pathways
bceo01110  Biosynthesis of secondary metabolites
bceo01120  Microbial metabolism in diverse environments
bceo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I35_5951
   00053 Ascorbate and aldarate metabolism
    I35_5951
   00620 Pyruvate metabolism
    I35_5951
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I35_5951
   00561 Glycerolipid metabolism
    I35_5951
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I35_5951
   00310 Lysine degradation
    I35_5951
   00330 Arginine and proline metabolism
    I35_5951
   00340 Histidine metabolism
    I35_5951
   00380 Tryptophan metabolism
    I35_5951
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I35_5951
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    I35_5951
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I35_5951
Enzymes [BR:bceo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     I35_5951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CDN63787
Position
2:complement(2201643..2202980)
Genome map
AA seq 445 aa AA seqDB search
MLFSDEADVDLAAKAASDAFATFSNTPLVERLKILEAVIAVYTERLQDMADAITLEMGAP
MEAISRPLQAALGLWHLHTTLEVAKQYPFERIQGTSRIVKEPVGVCGLITPWNWPMNQVM
CKVAPALVTGCTIVLKPSQNAPYSAIVLAEILEQAGVPPGVFNLVQGSGQRLGRAIASSP
LFDMVSLTGSTSAGVEVAQAAATTIKRVTLELGGKSANIILDSENFQQAVTHGVLQMMVN
SGQTCTAPSRMLVPAHRLDEAEKIAAAACAQVVVGDPRDPSTTMGPMANKRQHRKVQEMI
QAGIDEGALLLSGGLGSPPGLERGYYVKPTVFSRVNNQMTIATEEIFGPVLVIIPYRDES
DAVAIANDSPYGLSGYVYGESIEQAERVARKLRTGMVHLNGAAADIAAPFGGYKQSGNGR
EWGYAGIEEFLETKSMFGATPGAVS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgctgttctccgacgaggcggatgtggacctggcggcgaaggcggcgagcgatgccttc
gcaacgttctctaacacgccgctggtcgagcggctcaaaatactcgaggccgtgatcgcc
gtatacaccgagcgattgcaggatatggcggacgccatcacgctcgagatgggtgctccg
atggaagccatttcccgtccgctccaggcggcgctgggactctggcaccttcacacgacg
ctggaagtcgccaagcaatacccgttcgagcgaatccagggcacatcgcggatcgtgaag
gagccggtgggggtgtgcgggttgattaccccgtggaactggccgatgaaccaggtcatg
tgcaaggtcgcaccggcgttggtgacgggttgcacgattgtgttgaagcccagtcagaat
gcaccctattcggccatcgttctcgccgagatcctcgaacaggcaggcgtgccgccgggt
gtattcaatctcgttcagggctcggggcaacgcctgggacgggcgatcgcttccagtccg
ctcttcgacatggtgtcgctgacagggtcgacgagcgctggcgtggaggttgcccaggcc
gctgcaacgacgatcaagcgggtgacgctggagctcggggggaaatcggcgaacatcatt
ctggatagcgaaaactttcagcaggccgtgacgcacggcgtgctgcagatgatggtcaat
tccggtcagacgtgtaccgcgccgtcgcgaatgctggttccggcgcatcgcctcgacgag
gcggaaaaaattgccgcggctgcgtgcgcgcaggtcgtcgtcggcgatccgcgcgatccg
agcacgacgatgggcccgatggcgaacaagcgccagcatcggaaggtgcaggagatgatc
caggcgggaatcgacgagggcgcgctgctcctgtcgggcggacttggcagtcctcctggg
ctcgaaagaggttactacgtcaagccgaccgtcttcagccgcgtgaacaatcagatgacg
attgcgacggaggagattttcggtccggtactggtgatcattccctatcgggatgaatcc
gacgccgttgccattgccaacgactcgccgtacggtttgtcgggatacgtctatggagaa
tcgatcgagcaggcggagcgggttgcaagaaaactgcggaccgggatggtgcatttgaac
ggtgccgcagctgatatcgcagcgccgttcggcggttacaagcagtcaggaaatgggcgc
gaatggggctacgccggcatcgaggagttcctcgagacgaagtccatgttcggtgcgacc
ccgggtgcggtcagctga

DBGET integrated database retrieval system