KEGG   Burkholderia cenocepacia H111: I35_6414Help
Entry
I35_6414          CDS       T03804                                 

Definition
(GenBank) D-Glucuronolactone:NAD+ oxidoreductase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00040  Pentose and glucuronate interconversions
bceo00053  Ascorbate and aldarate metabolism
bceo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    I35_6414
   00053 Ascorbate and aldarate metabolism
    I35_6414
Enzymes [BR:bceo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     I35_6414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CDN64250
Position
2:complement(2759469..2761046)
Genome map
AA seq 525 aa AA seqDB search
MQLTGEMLIGAEAVAGSAGTLRAFDPTKGASIDVPAFGVATQADVDRACELARDAFDAYR
TQPLAARAAFLEAIADEIVALGDVLIERAHAETGLPVARLQGERGRTVGQLRLFARVVRD
GRFLAASIDPAQPARTPLPRSDLRLQKVALGPVVVFGASNFPLAFSVAGGDTASALAAGC
PVIVKAHEAHLGTSELVGRAIRAAVAKTGMPAGVFSLLVGPGRVIGAALVSHPAIQAVGF
TGSRQGGMALVQLANARPQPIPVYAEMSSINPVVLFPAALAARGDAIAAGFVDSLTLGVG
QFCTNPGLVLAIDGPDLDRFETVAAQALAKKPAGVMLTRGIADAYRHGRGKLAELSGVRE
IGAGEAAQTDCQAGGALYEVGAQAFLGEPAFSHEVFGPASLIVRCRDLDEVARVLDALEG
QLTATLQMDADDKPLARRLLPILERKAGRLLVNGYPTGVEVCDAMVHGGPFPATSNPAVT
SVGATAIERFLRPVCYQDFPDDLLPEGLQEGNPLAIPRLRDGKAE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgacaggagagatgctgatcggcgccgaagcggtggccggctcggccggaacc
ttgcgcgcgttcgacccgacgaagggcgcgtcgatcgacgtcccggcgttcggcgtcgcg
acgcaggccgacgtcgaccgcgcgtgcgaactcgcacgcgacgcgttcgatgcgtaccgc
acgcagccgctcgcggctcgtgcggcgtttctcgaagcgatcgccgatgaaatcgtcgcg
ctcggcgacgtgctgatcgagcgcgcgcacgccgaaacgggcctgcccgtcgcgcggctg
cagggcgagcgcggccgtaccgtcggccagctccggctgttcgcgcgtgtcgtgcgcgac
ggacgtttcctcgccgcgtcgatcgatcccgcgcagccggcgcgcacgccgctgccgcgt
tcggacctgcggctgcagaaagtcgcgctcgggcccgtcgtcgtgttcggcgcgagcaat
ttcccgctcgcgttctcggtggcgggcggcgataccgcgtcggcgctcgcggccggctgc
ccggtgatcgtgaaggcgcatgaagcgcacctcggcacgtccgagctggtcggccgcgcg
atccgtgccgccgtcgcgaaaaccggcatgccggccggcgtgttctcgctgctggtcggc
cccggccgcgtgatcggggcggcgctggtcagtcatccggcgatccaggccgtcggcttc
accggctcgcggcagggcgggatggcgctcgtgcagctcgcgaacgcgcgtccgcagccg
attcccgtctatgcggaaatgagcagcatcaacccggtcgtgctgttcccggccgcgctg
gccgcgcgcggcgacgcgatcgccgcgggcttcgtcgattcgctgacgctcggcgtcggc
cagttctgtaccaatccgggcctcgtgctcgcgatcgacggccccgatctcgaccgcttc
gagacggtcgccgcgcaggcgctcgcgaagaagccggccggcgtgatgctcacgcgcggc
atcgccgatgcgtaccgtcacggtcgcggcaagctggccgaactgtcgggcgtgcgcgaa
atcggcgcgggcgaggcggcgcagaccgactgccaggcgggcggcgcgctgtacgaagtg
ggcgcgcaggcgttcctgggcgagccggcattcagccacgaagtgttcgggccggcgtcg
ctgatcgtgcgctgtcgcgatctcgacgaagtcgcacgcgtgctcgacgcgctcgaaggc
cagttgacggccacgctgcagatggatgccgacgacaagccgctcgcgcgccggctgctg
ccgatcctcgagcgcaaggccgggcgcctgctggtcaacggctacccgaccggcgtcgag
gtgtgtgacgcgatggtgcacggcgggccgttccccgcgacgtcgaacccggccgtcacg
tcggtcggtgcgacggcgatcgagcgttttctgcggccggtgtgctatcaggacttcccg
gacgacctgctgcccgaagggttgcaggaaggcaacccgctcgcgattccgcggctgcgg
gacggcaaggcggagtga

DBGET integrated database retrieval system