KEGG   Burkholderia cenocepacia H111: I35_6565Help
Entry
I35_6565          CDS       T03804                                 

Gene name
ltaE
Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00260  Glycine, serine and threonine metabolism
bceo01100  Metabolic pathways
bceo01110  Biosynthesis of secondary metabolites
bceo01120  Microbial metabolism in diverse environments
bceo01130  Biosynthesis of antibiotics
bceo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I35_6565 (ltaE)
Enzymes [BR:bceo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     I35_6565 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CDN64401
Position
2:complement(2925597..2926610)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAETGDDVWGDDPTVLRLQAVTAERAGKEAGLFFPSGTQ
SNLAALMSHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPLAKIAAAI
KPLDNHFARTRLLALENTIGGQVLPEGYVQEAVAFARSRGLSTHLDGARVCNAAVASGRP
IAALCAPFDTVSICFSKGLGAPVGSVLVGSRALIERAQRWRKVLGGGMRQSGILAAACLY
ALDHNVERLADDHANAAHLAEGLARIDSVKVLSHATNMVFAQFPEADCAPLEAWLTERGI
LTQMLYASRFVTHCDVSRADIDTFLGAVGEYFSQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacacgtccgagccaggcgatgctggctgcaatg
accgccgccgaaaccggcgacgacgtctggggcgacgacccgaccgtcctgcgcctgcag
gcggtgacggccgagcgggccggcaaggaagccggcctgtttttcccgagcggcacgcag
agcaacctggccgcgctgatgtcgcattgcgagcgcggcgacgagtacatcgtcggccag
ctcgcgcacacctacaagtacgaaggcggcggcgcggccgtgctcggcagcatccagccg
caaccgatcgagaacgcgccggacggcacgctgccgcttgcgaagatcgctgcggcgatc
aagccgctcgacaatcactttgcccgcacgcgcctgctcgcgctcgaaaacacgatcggc
ggccaggtcttgccggaaggctatgtgcaggaagccgtcgcgttcgcgcgcagccgcggg
ctgtccacgcatctcgacggcgcgcgcgtctgcaatgcagcggttgcatcgggtcgcccg
atcgccgcgttgtgcgcgccgttcgacaccgtgtcgatctgcttctcgaaagggctcggt
gcgccggtcggctcggtgctggtcggcagccgtgcgctgatcgagcgcgcgcagcgctgg
cgcaaggtgctgggcggcgggatgcggcagtcgggcattctcgcggcggcgtgcctgtat
gcgctcgatcacaacgtcgagcggctcgcggacgatcacgcgaatgccgcgcatctcgcc
gaagggctcgcgcgcatcgactcggtgaaggtgctgtcgcatgcgacgaacatggtgttc
gcgcaattccccgaagccgattgcgcgccgctcgaggcatggctcacggaacgcgggatt
ctcacgcagatgctgtatgcgtcgcgcttcgtcacccactgcgacgtgtcgcgcgcggac
atcgacacgttcctcggcgcggtcggcgagtacttctcgcagcggcgcgcgtga

DBGET integrated database retrieval system