KEGG   Burkholderia cenocepacia H111: I35_7050Help
Entry
I35_7050          CDS       T03804                                 

Gene name
msuE
Definition
(GenBank) FMN reductase
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00740  Riboflavin metabolism
bceo00920  Sulfur metabolism
bceo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    I35_7050 (msuE)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    I35_7050 (msuE)
Enzymes [BR:bceo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     I35_7050 (msuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 DUF4148
Motif
Other DBs
NCBI-ProteinID: CDN64607
Position
3:57968..58528
Genome map
AA seq 186 aa AA seqDB search
MSHTLNVVAISGSLQRPSRTLALTDAIVTALGAALPIETRLIELGEIGSRLAGALTRAQV
PADLDALIRTIETADALVVASPVYRASYTGLFKHLFDLVRHDALVDVPVLLAATGGSERH
ALVIDHQLRPLFSFFQARTLPIGVYASESDFDQYQIASAALRERIALAVDRAVPQLRAPA
PSVAAA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccacactctcaacgtcgtcgcgatatcgggcagcctgcagcggccgtcgcgcacg
ctggcgctgaccgacgcgatcgttaccgcgctgggcgccgcgctgccgatcgagacgcgg
ctgatcgaactcggtgagatcggcagccggctggccggcgcgctgacgcgtgcgcaggta
ccggccgatctcgacgcgctgatccgcacgatcgagacggccgatgcgctggtcgtcgcg
agcccggtgtatcgcgcgtcgtacacgggtctcttcaagcacctgttcgacctcgtgcgc
cacgacgcgctcgtcgacgtgccggtgctgctcgcggctaccggcggcagcgagcggcat
gcgctcgtgatcgaccatcaactgcgcccgctgttcagcttcttccaggcgcgcacgctg
ccgatcggcgtgtacgcgtccgaaagcgatttcgaccagtaccagatcgccagtgcggcg
ttgcgcgagcgcatcgcgctcgccgtggaccgcgcggtgccgcaactgcgcgcgcccgcg
ccttccgtcgcggccgcgtaa

DBGET integrated database retrieval system