KEGG   Burkholderia cepacia ATCC 25416: APZ15_00020Help
Entry
APZ15_00020       CDS       T04772                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00450  Selenocompound metabolism
bcep00970  Aminoacyl-tRNA biosynthesis
bcep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    APZ15_00020
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APZ15_00020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcep01007]
    APZ15_00020
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcep03016]
    APZ15_00020
Enzymes [BR:bcep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     APZ15_00020
Amino acid related enzymes [BR:bcep01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   APZ15_00020
Transfer RNA biogenesis [BR:bcep03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    APZ15_00020
 Prokaryotic type
   Other AARSs
    APZ15_00020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALK16313
Position
1:3170..5323
Genome map
AA seq 717 aa AA seqDB search
MSASDLTSVQAAAPQGDRQILVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYY
IGADDTHGTPIMLRAEKEGLTPKQLIDRVWTEHKRDFDSFGVSFDNFYSTDSDENRVLSE
KIYVALQEAGFIAEREIEQAYDPVKEMFLPDRFIKGECPKCHAKDQYGDSCEVCGSTYLP
TELLNPYSVVSGATPVRKTSKHYFFRLSDPRCETFLREWVSGLAQPEATNKMREWLGDAG
ESKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCDRNGVDFDAWIRPG
STTEQYHFIGKDILYFHTLFWPAMLEFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQ
SYIDTGLNPEWLRYYFAAKLNATMEDIDLNLDDFQARVNSDLVGKYVNIASRAAGFLIKR
FDGRVQDSAMNHPLVVKLRDAIPGIAAHYEAREYGRALRHTMELADEVNAYVDGAKPWDL
AKDPANAVALHETCSVSLESFRLLSLALKPVMPRVAEAVESFFGIAPLAWADAAKPLSSE
QPIKAYQHLMTRVDPKQIEALLAANRDSLQAEATGAAAASANAAKEAKNAKVNAKPAAVN
GADDAPISIDDFAKIDLRIAKIVACQAVEGSDKLLQLTLDVGEEKTRNVFSGIKSAYQPE
QLVGKLTVMVANLAPRKMKFGLSEGMVLAASATDEKAEPGLYILEPHSGAKPGMRVK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatccgacctcacttccgtgcaggctgcggcgccgcaaggtgaccgccagatc
ctcgttacgtccgcactgccctatgccaacgggcagatccacatcggccacctggtcgag
tacatccagaccgacatctgggtgcggacgctgcgaatgcatggccatgaggtctactac
atcggcgccgacgacacgcacggcacgccgatcatgctgcgcgcggagaaggaaggcctg
accccgaagcagctgatcgaccgcgtgtggaccgagcacaagcgcgacttcgacagcttc
ggcgtgtcgttcgacaatttctactcgaccgattcggacgagaaccgcgtgctgagcgag
aagatctacgtcgcgctgcaggaagccggtttcatcgccgagcgcgagatcgagcaggcg
tacgatcccgtcaaggaaatgttcctgcccgaccgcttcatcaagggcgagtgcccgaag
tgccacgcgaaggatcagtacggcgacagctgcgaagtgtgcggttcgacctacctgccc
accgaactgctgaacccgtattcggtcgtatcgggcgcgacgccggtgcgcaagacgtcg
aagcactacttcttccgcctgtccgacccgcgctgcgaaacgttcctgcgcgaatgggtg
agcggcctcgcgcagcccgaagcgaccaacaagatgcgcgaatggctcggcgacgccggc
gagtccaagctcgccgactgggacatctcgcgcgacgcgccgtatttcggcttcgagatc
cctggcgcgcccggcaagtatttctacgtgtggctcgacgcgcccgtcggctactacgcg
agcttcaagaacctgtgcgaccgcaacggcgtcgacttcgacgcgtggatccgcccgggc
tcgaccaccgagcagtatcacttcatcggcaaggacatcctgtacttccacacgctgttc
tggcccgcgatgctcgagttctcgggccaccgcacgccgaccaacgtgttcgcgcacggc
ttcctgacggtcgacggcgcgaagatgtcgaagtcgcgcggcacgttcatcaccgcgcag
agctacatcgacacgggcctgaaccccgaatggctgcgctactacttcgccgcgaagctg
aacgcgacgatggaagacatcgacctgaacctcgacgatttccaggcgcgcgtgaacagc
gatctcgtcggcaagtacgtgaacatcgcgagccgcgcggcaggcttcctgatcaagcgc
ttcgacggccgcgtgcaggacagcgcgatgaaccatccgctcgtcgtgaagctgcgcgat
gcgattcccgggatcgccgcgcactacgaagcacgcgagtacggccgcgcgctgcgccac
acgatggagctcgcggacgaagtgaacgcgtacgtcgacggcgcgaaaccgtgggatctc
gcgaaggatccggccaacgcggtcgcgctgcacgaaacctgcagcgtgagcctcgagtcc
ttccgcctgctgtcgctcgcgctgaagccggtgatgccgcgcgtggccgaggccgtcgag
tcgttcttcgggatcgcgccgctcgcgtgggccgatgccgcgaagccgctgtcgtcggaa
cagccgatcaaggcgtaccagcacctgatgacgcgcgtcgacccgaagcagatcgaggca
ttgctcgccgcgaaccgcgattcgctgcaggccgaggccaccggcgcggccgccgcgagc
gcgaacgccgccaaggaggcgaagaacgccaaggtgaacgcgaagccggccgccgtgaac
ggcgccgacgatgcccccatctcgatcgacgatttcgcgaagatcgacctgcgcatcgcg
aagatcgtcgcgtgccaggccgtcgagggttcggacaagctgctgcagctcacgctcgac
gtcggcgaggaaaagacccgcaacgtgttctcgggcatcaagtcggcgtaccagcccgag
cagctcgtgggcaagctgaccgtgatggtcgcgaacctcgcgccgcgcaagatgaagttc
ggcctgtccgaagggatggtgctcgccgcgtcggccaccgacgagaaggcggaaccgggc
ctctacatcctcgagccgcacagcggcgcgaagcccggcatgcgcgtgaagtaa

DBGET integrated database retrieval system