KEGG   Burkholderia cepacia ATCC 25416: APZ15_01725Help
Entry
APZ15_01725       CDS       T04772                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00071  Fatty acid degradation
bcep00072  Synthesis and degradation of ketone bodies
bcep00280  Valine, leucine and isoleucine degradation
bcep00310  Lysine degradation
bcep00362  Benzoate degradation
bcep00380  Tryptophan metabolism
bcep00620  Pyruvate metabolism
bcep00630  Glyoxylate and dicarboxylate metabolism
bcep00640  Propanoate metabolism
bcep00650  Butanoate metabolism
bcep00900  Terpenoid backbone biosynthesis
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01120  Microbial metabolism in diverse environments
bcep01130  Biosynthesis of antibiotics
bcep01200  Carbon metabolism
bcep01212  Fatty acid metabolism
bcep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APZ15_01725
   00630 Glyoxylate and dicarboxylate metabolism
    APZ15_01725
   00640 Propanoate metabolism
    APZ15_01725
   00650 Butanoate metabolism
    APZ15_01725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APZ15_01725
   00072 Synthesis and degradation of ketone bodies
    APZ15_01725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APZ15_01725
   00310 Lysine degradation
    APZ15_01725
   00380 Tryptophan metabolism
    APZ15_01725
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APZ15_01725
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APZ15_01725
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APZ15_01725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcep04147]
    APZ15_01725
Enzymes [BR:bcep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APZ15_01725
Exosome [BR:bcep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APZ15_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALK19469
UniProt: A0A088TIG8
Position
1:complement(372010..373191)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGAAVIRAVLERAGVKPEQVSEVIMGQVLTAG
SGQNPARQSLIKAGLPTAVPGMTINKVCGSGLKAVMLAANAIVAGDADIVIAGGQENMSA
SPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREEQDAFAA
LSQNKAEAAQKAGRFDDEIVPVSIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFSKDG
SVTAANASGLNDGAAAVLVMSAQKAAALGLTPLAKIKAYANAGVDPSVMGMGPVPASRRC
LERAGWTPGDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMAKRDAKRGLASLCIGGGMGVALAVERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtagtgatcgtatcggccgcgcggaccgcggtcggcaaattcggcggttcg
cttgcgaagattgcagcacccgaactgggcgcggcggtgatccgcgcagtgctggagcgc
gcgggcgtgaagcccgagcaggtgagcgaagtgatcatgggccaggtgctgacggccggc
tcgggccagaacccggcgcggcagtcgctgatcaaggccgggctgccgacggccgtgccg
gggatgacgatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggcagcaaac
gcgatcgtcgcgggcgacgcggacatcgtgatcgcgggcggccaggagaacatgagcgcg
tcgccgcacgtgctgccgggctcgcgtgacggcttccggatgggcgatgcgaagctggtc
gacacgatgatcgtcgacggcctgtgggatgtgtacaaccagtaccacatgggcatcacg
gcggagaacgtcgcgaaggaatacgggatcacgcgcgaagagcaggacgcattcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaggccggccgcttcgacgacgagatcgtg
ccggtgtcgatcccgcaacgcaagggcgagccgctgcagttcgcgaccgacgagttcgtg
cgtcacggcgtgacggcggagtcgctggccgggctgaagccggcgttctcgaaggacggc
tcggtgacggcggcgaacgcgtcggggctgaacgacggcgcggcggcggtgctggtgatg
tcggcgcagaaggcggcggcgctgggtctgacgccgctggcgaagatcaaggcctacgcg
aacgcgggcgtcgatccgagcgtgatggggatgggcccggtgccggcatcgcgccggtgc
ctggagcgcgcgggctggacgccgggcgacctggacctgatggagatcaacgaggcgttc
gcggcgcaggcgctggcggtgcaccagcagatgggctgggacacgtcgaaggtgaacgtg
aacggcggggcgattgcgatcggtcacccgatcggcgcgtcgggctgccggatcctggtg
acgctgctgcacgagatggccaagcgcgacgcgaagcgcgggctggcgtcgctgtgcatc
ggcggcgggatgggcgtcgcgctcgcggtcgagcgcgcctga

DBGET integrated database retrieval system