KEGG   Burkholderia cepacia ATCC 25416: APZ15_06095Help
Entry
APZ15_06095       CDS       T04772                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00130  Ubiquinone and other terpenoid-quinone biosynthesis
bcep00627  Aminobenzoate degradation
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01120  Microbial metabolism in diverse environments
bcep01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    APZ15_06095
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    APZ15_06095
Enzymes [BR:bcep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     APZ15_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ALK17405
Position
1:complement(1329042..1329638)
Genome map
AA seq 198 aa AA seqDB search
MASPSAPPRRLIVAITGATGAIYGVRLLDLLRAAGGVETHLLISNAGWLNIQHELKLSKA
EVESRADVVHSVRDVGATIASGSFATDGMVIAPCSMKTLASVAHGLSDNLITRAADVTLK
ERRRLVLMVRETPFNLAHLRNMTAVTEMGGIVFPPLPAFYAMPKTIEELVDQTVTRVLDL
FALSAPMTTPWAGIRPGQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcccagcgcgccgccacgccggctgatcgtcgcgatcaccggcgccaccggc
gcgatctacggcgtacggctgctcgacctgctgcgcgccgccggcggcgtcgaaacgcac
ctgctgatttcgaacgccggctggctcaacatccagcacgaactgaagctgtcgaaggcc
gaggtcgaaagccgtgcggacgtcgtgcactcggtgcgcgacgtcggcgcgacgatcgca
tcggggtcgttcgcgaccgacgggatggtgatcgcgccctgctcgatgaagacgctcgcg
agcgtcgcgcacgggctgtccgacaacctgatcacgcgcgcggccgacgtcacgttgaag
gagcgccgccgcctcgtgctgatggtgcgcgaaacgccgttcaacctcgcgcatctgcgc
aacatgacggccgtgaccgaaatgggcggcatcgtcttcccgccgctacccgcgttctac
gcaatgccgaagacgatcgaggaactcgtcgaccagaccgtcacccgcgtgctcgacctg
ttcgcgctcagtgcaccgatgacgacgccgtgggccggcatccggccggggcagtaa

DBGET integrated database retrieval system