KEGG   Burkholderia cepacia ATCC 25416: APZ15_07725Help
Entry
APZ15_07725       CDS       T04772                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00360  Phenylalanine metabolism
bcep01100  Metabolic pathways
bcep01120  Microbial metabolism in diverse environments
bcep01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    APZ15_07725
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     APZ15_07725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 Pyr_redox_3 HI0933_like FAD_binding_2 GIDA NAD_binding_8 Lycopene_cycl FAD_oxidored Pyr_redox Thi4 UDPG_MGDP_dh_N 3HCDH_N ApbA TrkA_N
Motif
Other DBs
NCBI-ProteinID: ALK17693
Position
1:1699652..1701304
Genome map
AA seq 550 aa AA seqDB search
MSIDYQTLKFEYRPRAQDATVHPVIVVGAGPVGLAAAIDLAQQGVPVVLLDDDDTLSTGS
RAICFAKRTLEIFDRLGCGERFVDKGVSWHVGKVFLQDEQLYAFDLLPEEGHARPAFINL
QQYYVEGYLADRAFELPNIDIRWKHKVTGIEQAAEHAVLTIETPEGIATLRAQYVIAADG
SRSPMRTMMGLESRGRTFKDRFLIADVKMKAEFPTERWFWFDPPFHPNQSVLLHRQPDNV
WRIDFQLGWDADPVAEKQPERVIPRVRALLGPDVEFELEWVSVYTFRCQRMDTFRHGRVL
FAGDSAHGVSPFGARGANSGVQDADNLAWKLKLVLDGRSADSLLDTYASEREFAADENIR
NSTRSTDFITPKSPVSRVFRDATLKLARDCEFARKLVNSGRLSVPAVLADSPLNTPDRNG
DAFAGAMRPGAAAADAPVRAQGASGWLLQHLGSGFTGVLFGLPGDAGALAQALDGLALPV
RPVLVVPAGHAQPVAGVDVVEDVDGFAAQRYDAKPGTFYLLRPDQHVCARMRTLERQALA
DALARATCAR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgattaccagacgctgaagttcgaataccgtccgcgtgcgcaggacgcgacc
gttcacccggtgatcgtcgtcggcgcgggcccggtgggtctcgcggcggcgatcgacctc
gcgcagcagggcgtgcccgtcgtgctgctcgacgacgacgacacgctgtccaccggctcg
cgcgcgatctgcttcgcgaagcgcacgctcgagatcttcgaccggctcggctgcggcgag
cgcttcgtcgacaagggcgtcagctggcacgtcggcaaggtgttcctgcaggacgagcag
ctgtacgcattcgacctgctgcccgaggaagggcacgcgcgccccgcgttcatcaatctg
cagcagtactacgtcgaaggttatctggccgaccgcgcgttcgagctgccgaacatcgat
atccgctggaagcacaaggtgacgggcatcgagcaggcggccgaacacgcggtgctgacg
atcgagacgccggaaggcatcgcgacgctgcgcgcgcagtacgtgatcgcggccgacggc
tcgcgcagcccgatgcgcacgatgatgggcctcgaaagccgcggccgcacgttcaaggac
cgcttcctgatcgccgacgtgaagatgaaggcggagtttccgaccgagcgctggttctgg
ttcgacccgccgttccaccccaatcagtcggtgctgctgcatcgccagcccgacaacgtg
tggcgcatcgacttccagctcggctgggatgccgatccggtcgccgagaagcagccggag
cgcgtgatcccgcgcgtgcgcgcgctgctcgggccggacgtcgagttcgagctcgaatgg
gtgagcgtctatacgttccgctgccagcggatggatacgttccgccacggccgcgtgctg
ttcgcgggcgactccgcgcacggcgtgtcgccgttcggcgcgcgcggcgcgaacagcggt
gtgcaggatgccgacaacctcgcctggaagctgaagctcgtgctcgacggccgttcggcc
gacagcctgctcgatacgtatgcgagcgagcgcgagttcgccgccgacgagaacatccgc
aactcgacgcgctcgacggacttcatcacgccgaaaagcccggtgtcgcgcgtattccgc
gacgcgacgctgaagctcgcgcgcgactgcgagttcgcgcgcaagctcgtgaacagcggc
cgcctgtcggtgccggcggtgctggccgattcgccgctgaacacgccggaccgcaatggc
gacgcattcgcgggcgcgatgcgcccgggcgcggcggcagccgatgcgccggtgcgtgcg
cagggcgcgtcgggctggctgctccagcatctgggcagcggcttcaccggcgtgctgttc
gggctgccgggcgatgcgggcgcgctcgcgcaggcgctcgacggcctcgcgctgccggtg
cggcccgtgctcgtcgtgccggccgggcacgcgcagccggtcgcgggtgtcgacgtcgtg
gaggacgtcgacggtttcgccgcgcaacgctacgacgcgaagccaggcacgttctacctg
ctgcgccccgaccagcatgtctgcgcccgcatgcgcacgctcgagcgtcaggcgcttgcc
gacgcactggcgcgcgcgacctgcgcacgctga

DBGET integrated database retrieval system