KEGG   Burkholderia cepacia ATCC 25416: APZ15_18130Help
Entry
APZ15_18130       CDS       T04772                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00430  Taurine and hypotaurine metabolism
bcep00460  Cyanoamino acid metabolism
bcep00480  Glutathione metabolism
bcep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    APZ15_18130
   00460 Cyanoamino acid metabolism
    APZ15_18130
   00480 Glutathione metabolism
    APZ15_18130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcep01002]
    APZ15_18130
Enzymes [BR:bcep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     APZ15_18130
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     APZ15_18130
Peptidases and inhibitors [BR:bcep01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   APZ15_18130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ALK19808
Position
2:complement(152597..154318)
Genome map
AA seq 573 aa AA seqDB search
MTTLNRFKSSAVVLATVAGIGFLPNAPVYAKGPQPAVLTSSAVAVADKYSADAAERIFKE
GGNAIDAAVAIAFTLAVTYPEAGNIGGGGFMTIYKDGKPYFIDYRERAPLAATKDMYLDK
DGNVVKGMSLYGPRAVGVPGTVAGMWEAQKRFGKLKWKQVLAPAIHYARDGFVVDEQLAQ
RGVDASKEFGGKTNFDKYFSGLKAGVNFKQPDLADVLTRIANDGAEGFYKGKTAELIAAS
MKTGDGNGLITTEDLAQYRAVWRQPVQAKWNGYDVITAPPPSSGGIGLVQLLKMKADLKQ
DFEGVKLNSPQYIHLVAEIEKRVFADRAQYLGDPDFYKVPIAQLTDDAYIAKRAAEVNPK
EPSDTKSVQPGLGTTMPEKAETTHFSVVDKWGNAVSNTYTVNGYFGSGVIADGTGIVLND
EMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSSMSPTIMTKDGKVSLVIGTPGGSRIFT
SIFQVINNIYDFKMPLKEAVGAMRFHHQLLPPNTIFWEPYHPIEGELAKQIEARGYTLKG
QDFSGDIQVIKIDGKTPEAMADPRGRGVTRVIR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgactacgctgaatcgcttcaaatcatccgctgtcgtgctcgcgacggtggccggcatc
ggtttcctgccgaacgcacccgtctatgcgaaggggccgcagccggccgtcctgacgagc
tcggcggtcgcggtggccgacaagtacagcgcggatgccgcggagcggatcttcaaggaa
ggcggcaacgcgatcgacgcggccgtcgcgatcgccttcacgctcgccgtcacgtatccg
gaagccggcaacatcggcggcggcggcttcatgacgatctacaaggacggcaagccgtac
ttcatcgactaccgtgagcgtgcgccgctcgccgcgacgaaggacatgtatctcgacaag
gacggcaacgtcgtcaagggcatgagcctgtacggcccgcgcgcggtcggcgtaccgggc
acggtcgcgggcatgtgggaagcgcagaagcgcttcggcaagctgaagtggaagcaggtg
ctcgcgccggcgatccactatgcacgcgatggcttcgtcgtcgacgagcagctcgcgcag
cgcggcgtcgacgcgtcgaaggagttcggcggcaagaccaacttcgacaagtatttctcc
gggctgaaggcgggcgtgaacttcaagcagcccgatctcgccgacgtgctcacgcgcatc
gcgaacgacggcgcggaaggtttctacaagggcaagacggccgagctgatcgccgcgtcg
atgaagaccggcgacggcaacgggctgatcaccaccgaggatctcgcgcagtaccgcgcg
gtgtggcgccagccggtgcaggcgaagtggaacggctatgacgtgatcaccgcgccgccg
ccgagctcgggcggcatcggcctcgtgcagttgctgaagatgaaggccgacctcaagcag
gacttcgagggcgtgaagctcaactcgccgcagtacatccacctcgtcgcggaaatcgag
aagcgcgtgttcgccgatcgtgcgcagtatctcggcgatcccgatttctacaaggtgccg
atcgcgcagctgaccgacgacgcctatatcgcgaagcgggcggccgaagtcaacccgaag
gagccgtcggatacgaagagcgtgcagccgggcctcggcacgacgatgccggagaaggct
gaaacgacgcacttctcggtggtcgacaagtggggcaacgcggtgtcgaacacctacacg
gtcaacggctatttcggttcgggcgtgatcgccgacggcacgggcatcgtgctgaacgac
gagatggacgacttctccgcgaagccgggcgtggcgaacatgttcggcgtggtcggcagc
gacgcgaacgcgatcgaaccgaagaagcgcccgctgtcgtcgatgtcgccgacgatcatg
acgaaggacggcaaggtgtcgctggtgatcggcacgccgggcggctcgcgtatcttcacg
tcgatcttccaggtgatcaacaacatctacgatttcaagatgccgttgaaggaggccgtc
ggcgcgatgcgcttccatcaccagctgctgccgccgaacacgatcttctgggagccgtac
cacccgatcgaaggcgaactcgcgaagcagatcgaggcgcgcggctacacgctgaagggg
caggatttcagcggcgacatccaggtgatcaagatcgacggcaagacgccggaggcgatg
gccgacccgcgcgggcgtggtgtgacgcgggtcattcgctga

DBGET integrated database retrieval system