KEGG   Burkholderia cepacia ATCC 25416: APZ15_27190Help
Entry
APZ15_27190       CDS       T04772                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00053  Ascorbate and aldarate metabolism
bcep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    APZ15_27190
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     APZ15_27190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: ALK21435
Position
2:2206840..2207676
Genome map
AA seq 278 aa AA seqDB search
MNASSTGARKPFGRLLLTGAAGNLGRQLRGALADWADVVRVSDIATLGDAAAHEETRVVD
LADRPAVMQLVDGVDAIVHLGGISVDAPFDDLVGANITGTYNLYEAARKHGVKRVVFASS
NHAIGFHPVTEVLDADSPLRPDSLYGVTKCFGESLSRYYFDRFGIETVCLRIGSSFEVPK
NPRMLVTFLSYRDFIELVRCSLLTNRVGHAIVYGASDNPVKWWDNTKAGFLGFRPRDSSE
QFAGLFPVAAPTADYDDPAQRFQGGGFVVGEPMERNAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctcatccaccggcgcgcgcaaaccgttcgggcgcctgctgctgacgggcgcg
gccggcaacctcggccgccagttgcgcggcgcgctcgccgactgggccgacgtcgtgcgc
gtcagcgacatcgcgacgctcggcgacgcggccgcgcatgaagaaacccgcgtcgtcgat
ctggccgatcgcccggccgtgatgcagctcgtcgacggcgtggacgcgatcgtccatctc
ggcggcatttcggtcgatgcaccgttcgacgatctcgtcggtgcgaacatcaccggcacg
tacaacctgtacgaagccgcgcgcaagcatggcgtgaagcgcgtcgtgttcgcgagctcg
aaccatgcgatcggtttccatccggtcacggaagtgctcgatgccgattcgccgctgcgc
cccgacagcctgtatggcgtgacgaagtgcttcggcgaatcgctgtcgcgctattacttc
gaccgcttcgggatcgagacggtatgcctgcggatcggctcgtcgttcgaagtaccgaag
aatccgcgcatgctggtgacgttcctcagctatcgcgacttcatcgagctcgtgcgctgc
tcgctgctgacgaaccgcgtcgggcatgcgatcgtgtacggcgcgtcggacaacccggtg
aagtggtgggacaacacgaaggccggcttcctcggcttccgcccgcgcgacagttcggag
cagttcgccgggttgttcccggtggcggcgccgaccgccgactacgacgatcccgcgcag
cggttccagggcggcgggttcgtcgtcggcgagccgatggagcgcaacgcggcgtaa

DBGET integrated database retrieval system