KEGG   Burkholderia cepacia ATCC 25416: APZ15_30490Help
Entry
APZ15_30490       CDS       T04772                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    APZ15_30490
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     APZ15_30490
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     APZ15_30490
    1.1.1.-  
     APZ15_30490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO NSP10
Motif
Other DBs
NCBI-ProteinID: ALK22036
Position
2:complement(2972174..2973238)
Genome map
AA seq 354 aa AA seqDB search
MKAAVWHGRHDIRVEQVPVPARPPAGWVTIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAELGAGVTGFAVGDRVTADACQHCGTCWYCRHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYKLPDGFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGASVVIDPKRSDAIAEVKALTDGY
GADVSFECIGHTATAKLAIDVIRKAGKSVMVGIFEEPAPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVSHGFEELVNHKDRNVKIIVRPAVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcacggccgccacgacatccgcgtcgaacaggttcccgttccg
gcgcgcccgccggccggctgggtcacgattcgcgtgcactggtgcgggatctgcggctcc
gacctgcacgaatacgtcgcgggccccgtcttcatcccggtcgacgcgccgcatccgctg
acgggcctgaagggccagtgcatcctcggccacgagttcagcggcgagatcgccgagctc
ggcgcgggcgtgaccggcttcgcggtcggcgaccgcgtgacggccgacgcatgccagcat
tgcggcacctgctggtattgccggcacgggctgtacaacatctgcgagaacctcgcgttc
accgggctgatgaacaacggtgcgttcgccgaatacgtgaacgtgccggccgagttgctg
tacaagctgcccgacggtttcccgaccgaggccggcgcgctgatcgagccgctcgcggtc
gggctgcatgcggtcaagaaggccggcaacatcgtcgggcagaccgtcgtcgtggtcggc
gcgggcacgatcggcctgtgcacgatcatgtgcgcgaaggccgcgggcgccgggcgcgtg
atcgcgctggagatgtcggccgcgcgcaagcagaaggcgcttgaggtcggcgcgagcgtc
gtcatcgatccgaagaggtccgacgcgatcgccgaagtcaaggcgctgaccgacggctac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccacggcgaagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcatcttcgaggagccggcaccgttc
aacttcttcgacatcgtgtcgaccgaaaaggaagtgatcggctcgctcgcgtacaacggc
gagttcgcggacgtgatccgcttcatcgcggacggccgcatcgacgtgcagccgctcatc
accgggcgcatcgcgctcggcgacatcgtctcgcacggcttcgaggaactggtcaatcac
aaggaccgtaacgtgaagatcatcgttcggcccgccgtcgcctga

DBGET integrated database retrieval system