KEGG   Bacillus cereus FRI-35: BCK_08630Help
Entry
BCK_08630         CDS       T02291                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00071  Fatty acid degradation
bcer00072  Synthesis and degradation of ketone bodies
bcer00280  Valine, leucine and isoleucine degradation
bcer00310  Lysine degradation
bcer00362  Benzoate degradation
bcer00380  Tryptophan metabolism
bcer00620  Pyruvate metabolism
bcer00630  Glyoxylate and dicarboxylate metabolism
bcer00640  Propanoate metabolism
bcer00650  Butanoate metabolism
bcer00900  Terpenoid backbone biosynthesis
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01120  Microbial metabolism in diverse environments
bcer01130  Biosynthesis of antibiotics
bcer01200  Carbon metabolism
bcer01212  Fatty acid metabolism
bcer02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCK_08630
   00630 Glyoxylate and dicarboxylate metabolism
    BCK_08630
   00640 Propanoate metabolism
    BCK_08630
   00650 Butanoate metabolism
    BCK_08630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCK_08630
   00072 Synthesis and degradation of ketone bodies
    BCK_08630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCK_08630
   00310 Lysine degradation
    BCK_08630
   00380 Tryptophan metabolism
    BCK_08630
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCK_08630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCK_08630
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCK_08630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcer04147]
    BCK_08630
Enzymes [BR:bcer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCK_08630
Exosome [BR:bcer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCK_08630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFQ09633
Position
1751780..1752961
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVVDLNIADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHNEGRFEEEIVPVTIPQRKGDPIVVAKDEAPRADTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccagttgggaaatttggagggtct
ttaaaagatgtaaaagcaacagaacttggagggattgcaattaaagcggcgcttgaaaga
gcaaatgtttctgctagtgatgttgaggaagttatattcggaacggttattcaaggtgga
cagggacaaattccatcacgccaagcggcgagggctgctggaatcccttgggaagtgcag
acggaaacagtgaataaagtttgtgcgtcggggcttcgtgcggttacgttagcggatcaa
attattcgtactggcgatcaatcattgattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatacagaatgggcaacaacgaagtcgtt
gatttaaacattgctgacggtttaacatgcgcattttctggtatacacatgggtgtttat
ggcggagaagttgcgaaggaagatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccaccaacgtgcggtttcagcacataatgaaggacgttttgaagaggaaatcgtg
ccagtaacgattccgcaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgcca
cgcgcggatacaacaattgaaaagttagcaaaattaaaacctgtatttgataaaacagcg
acagtgacagctggtaatgcaccaggcttaaacgatggtggtgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagacaattgaagacatcgatttattcgagattaatgaagcattt
gcagcagtagcaattgcaagtacagagattgcgggaattgatccagaaaaattgaatgta
aatggtggcgcagtggcgatggggcatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcactgaagcaacgcggcggcggaattggaattgcttcgatttgtagc
ggtggtggtcaaggtgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system