KEGG   Bacillus cereus FRI-35: BCK_20050Help
Entry
BCK_20050         CDS       T02291                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00020  Citrate cycle (TCA cycle)
bcer00620  Pyruvate metabolism
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01120  Microbial metabolism in diverse environments
bcer01130  Biosynthesis of antibiotics
bcer01200  Carbon metabolism
Module
bcer_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcer_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCK_20050
   00620 Pyruvate metabolism
    BCK_20050
Enzymes [BR:bcer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BCK_20050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFQ11897
Position
complement(3931906..3933408)
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKSDGSIDISKAVKVNEQFQLSRQFWAYLVKSKLIRNPQDFIMPLPHMSLV
QGEKNVQFLKNRFEALSKNPLFQGMEFSDAPETLKKWLPLIMEGRTSNEPMAATKIDSGT
DVNFGALTRMLFDYLQTKDVELNYKHSVENIKRTKNGLWEVKVHDMNSGKIEHHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNQKVVEQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEMGLTKY
LIQQVMLSHEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPSRMVEWEGKIKEMIPSYGISLTENPRLFQ
DLHTSTGRTLGLNEKETVHN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgcaggaattatgagtgca
acgttaggctcattactaaaagaattagcacctgaatgggaaattaaagtttttgaaaaa
ctcgctagtgccggggaagagagctctaatgaatggaataatgcaggtacagggcattct
gcactatgcgaactgaactatacttccgaaaaatctgacggatctatagatattagtaag
gctgtaaaagtgaatgaacaattccagctttcaagacaattttgggcatatcttgtaaaa
agcaaattaattcgtaatccacaagatttcattatgcctctacctcatatgagtttagta
caaggtgaaaaaaatgttcagtttctaaaaaaccgttttgaagcgctttcaaaaaatcca
ctgtttcaaggaatggaattttccgatgctcctgaaacattaaaaaaatggcttccactc
attatggaaggtcgtacatctaatgaacctatggcggcaacgaagattgactctggaaca
gatgttaacttcggtgcattaacacgaatgttgtttgattacttacaaacgaaagatgtc
gagctaaactacaaacatagtgtcgaaaatattaaacgcacgaagaatggtttgtgggaa
gtaaaagtacacgatatgaatagtggtaaaatcgagcatcatactgcaaaattcgtcttt
atcggtggcggcggcggtagtctacctctactacaaaagactggtattcctgaatcaaaa
catatcggtggattcccagtaagtggactatttatggtatgtaaaaaccaaaaagttgta
gagcaacatcatgcaaaagtatacggtaaagctaaagttggcgctccgccaatgtctgta
cctcaccttgatacgagatatatagacaataaaaaagctttactatttggaccgttcgca
gggttctctcctaagttcttaaaaactggttcaaaccttgacttaattggttctgtaaaa
ccgaataacgtcttaacgatgttagctgctggtgtaaaagaaatgggattaacaaaatac
ttaattcaacaagttatgttatcacacgaaaaacgtatggaagaattacgcgaattcatt
ccgaacgcgaaaagtgaagattgggatattgtagttgctggtcagcgtgtacaagtaatt
aaagatactgacgctggcggtaaaggaacacttcaattcggtacagaagttgttagtgcg
gctgatggatcaattgcagcgttactaggtgcatcaccgggtgcttctactgccgttcat
gttatgcttgaagtattagaaaaatgtttcccaagccgaatggtagaatgggaagggaaa
ataaaagaaatgattccttcttacggcatttcattaacagaaaatccaagattattccaa
gaccttcacacttctacaggtcgtacccttggattaaatgaaaaagaaacagttcataac
taa

DBGET integrated database retrieval system