KEGG   Brucella ceti TE10759-12: V910_100548Help
Entry
V910_100548       CDS       T02934                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
bcet  Brucella ceti TE10759-12
Brite
KEGG Orthology (KO) [BR:bcet00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    V910_100548
Enzymes [BR:bcet01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     V910_100548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_2 MTS FtsJ RrnaAD Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AHA99128
Position
1:572687..573454
Genome map
AA seq 255 aa AA seqDB search
MKDWSAKQYLKFEDERSRPARDLLAQIPLSAPRKVVDIGCGPGNSTKLLVERWPDAQISG
FDTSPDMIDTAKTHLPDVEFFISDAASFEPDAETDVLFSNAVFQWLPDHVEQLQRLLSLL
QPGAFLAVQMPDNTGEQTHVGMRDVAKTAPFAMKIATKGRAALPPVATYYNAFADDAARI
DIWHTIYNHPLAGVDAIVEWVKGTGLRPFLDPLDEQEQADYLKAYKARIAEHYPMTADGK
VLLRFPRIFLVVQKK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactggtctgcaaaacagtatctgaagtttgaagatgaacgcagccgcccggcg
cgcgatcttctggcgcagatacctctgtcggcgccgcgcaaggtggtggatatcggctgt
ggacccggcaattcgaccaaacttcttgtggagcgctggccggatgcgcagatttcgggc
tttgatacgtcgccagacatgatcgacacggcgaagacccatctgccggatgtggagttc
ttcatcagtgatgccgccagtttcgagccggatgccgaaacggacgtgttgttctccaac
gctgtcttccagtggctgcccgaccatgttgagcaattgcagcggctgctgtcgctgctg
caacccggcgcgtttctggcagtacagatgcctgacaatacgggcgaacaaacccatgtc
gggatgcgcgatgttgcgaagaccgcgccttttgctatgaagatcgctaccaagggcagg
gcggctttgccgccggttgcgacctactacaatgctttcgcagacgatgcggcgcggatc
gacatctggcatacgatctacaatcatccgctcgctggcgtggatgccatcgtggaatgg
gtaaaggggacaggattgcgaccgtttctcgatccgctcgatgaacaggagcaggcggat
tatctaaaggcatacaaggcgaggatagctgaacattatcccatgaccgccgacgggaaa
gttctgctgcggttcccacgtatttttctggttgttcagaagaaatag

DBGET integrated database retrieval system