KEGG   Brucella ceti TE10759-12: V910_200490Help
Entry
V910_200490       CDS       T02934                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcet  Brucella ceti TE10759-12
Pathway
bcet00071  Fatty acid degradation
bcet00072  Synthesis and degradation of ketone bodies
bcet00280  Valine, leucine and isoleucine degradation
bcet00310  Lysine degradation
bcet00362  Benzoate degradation
bcet00380  Tryptophan metabolism
bcet00620  Pyruvate metabolism
bcet00630  Glyoxylate and dicarboxylate metabolism
bcet00640  Propanoate metabolism
bcet00650  Butanoate metabolism
bcet00900  Terpenoid backbone biosynthesis
bcet01100  Metabolic pathways
bcet01110  Biosynthesis of secondary metabolites
bcet01120  Microbial metabolism in diverse environments
bcet01130  Biosynthesis of antibiotics
bcet01200  Carbon metabolism
bcet01212  Fatty acid metabolism
bcet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V910_200490
   00630 Glyoxylate and dicarboxylate metabolism
    V910_200490
   00640 Propanoate metabolism
    V910_200490
   00650 Butanoate metabolism
    V910_200490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V910_200490
   00072 Synthesis and degradation of ketone bodies
    V910_200490
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V910_200490
   00310 Lysine degradation
    V910_200490
   00380 Tryptophan metabolism
    V910_200490
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V910_200490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V910_200490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V910_200490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcet04147]
    V910_200490
Enzymes [BR:bcet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V910_200490
Exosome [BR:bcet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V910_200490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHB00779
Position
2:514587..515795
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSSGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgagcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggtatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system