KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_1127Help
Entry
DM40_1127         CDS       T03488                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00730  Thiamine metabolism
bcew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DM40_1127
Enzymes [BR:bcew01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     DM40_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 3HCDH_N ApbA
Motif
Other DBs
NCBI-ProteinID: AIO42855
Position
1:1226950..1228086
Genome map
AA seq 378 aa AA seqDB search
MNLHASRPDFAVLGGGLVGRLIAWRLAGDGHRVALYERGGPDGEQSAAWIAAAMLAPLAE
AASAERLIAELGAASLARWPQWLAELPESVFFQHRGTLVVWHHADRAEAPLFERRVRANA
PAELFDGGFIALAGAQVDAAEPALAGRFARGLMLPREGQLDNRQALRALAAGLAQRGVAL
HWHATIDDANRPDAHFTIDCRGLGAKSALPALRGIRGEVARVRAPGIGLTRPVRLLHPRY
PLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFSVHPAFGEARILELNAQCRP
TLPDHRPAVIWDGATTLAVNGLYRHGFMIAPEVAHAAVEFAQAALGGAFADTDAFDAWRD
AARWPTLLHHRDDARQPA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgcttcccggcccgatttcgcggtactcggcggcggcctcgtcggccgc
ctgatcgcgtggcggctcgcgggcgacgggcaccgcgtcgcgctgtacgagcgcggcggt
ccggacggcgagcagtcggccgcgtggatcgcggccgcgatgctcgcgccgctcgccgag
gcggcgagcgccgaacgcctgattgccgagcttggcgcggcgtcgctcgcgcgctggccg
cagtggctcgccgagcttcctgaatccgtattctttcagcatcgcggcacgctcgtcgtc
tggcatcacgcggatcgcgcggaggcgccgctgttcgaacggcgcgtgcgcgcgaacgcg
ccggccgagctgttcgacggcggcttcatcgcgttggccggcgcgcaggtcgacgcggcc
gagcccgcactcgccgggcgcttcgcgcgcgggctgatgctgccgcgcgaagggcagctc
gacaaccggcaggcgttgcgcgcgctcgcggcgggcctcgcgcaacgcggcgtcgcgctg
cactggcacgcgacgatcgacgacgcgaaccggcccgacgcgcatttcacgatcgactgc
cgcggcctcggcgccaaatccgcgctgcctgcgctgcgcggcatccgcggcgaggttgcg
cgcgtgcgggcgcccggcatcggtctcacgcggccggtgcggctgctgcatccgcgctat
ccgctgtacatcgcgccgaagcaggacgacctgtatgtgatcggcgcgaccgaggtcgag
ggcgaggacatgtcgccggtcagcgtgcgctccgcgctcgaactgctgagcgcggcgttc
tccgttcatccggccttcggcgaggcgcgcatccttgaactcaacgcgcagtgccgaccg
acgctgcccgatcatcgcccggcggtgatctgggacggcgcgacgacgctggccgtcaac
ggcctgtaccggcatggcttcatgatcgcgccggaagtcgcgcacgcggcggttgaattc
gcgcaggccgcgctcggcggcgcgttcgccgataccgacgcgttcgacgcatggcgcgat
gccgcgcgctggccgacgctccttcaccatcgcgacgacgcacgccagccggcctga

DBGET integrated database retrieval system