KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_1245Help
Entry
DM40_1245         CDS       T03488                                 

Gene name
pcaF
Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00071  Fatty acid degradation
bcew00072  Synthesis and degradation of ketone bodies
bcew00280  Valine, leucine and isoleucine degradation
bcew00310  Lysine degradation
bcew00362  Benzoate degradation
bcew00380  Tryptophan metabolism
bcew00620  Pyruvate metabolism
bcew00630  Glyoxylate and dicarboxylate metabolism
bcew00640  Propanoate metabolism
bcew00650  Butanoate metabolism
bcew00900  Terpenoid backbone biosynthesis
bcew01100  Metabolic pathways
bcew01110  Biosynthesis of secondary metabolites
bcew01120  Microbial metabolism in diverse environments
bcew01130  Biosynthesis of antibiotics
bcew01200  Carbon metabolism
bcew01212  Fatty acid metabolism
bcew02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM40_1245 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    DM40_1245 (pcaF)
   00640 Propanoate metabolism
    DM40_1245 (pcaF)
   00650 Butanoate metabolism
    DM40_1245 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM40_1245 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    DM40_1245 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM40_1245 (pcaF)
   00310 Lysine degradation
    DM40_1245 (pcaF)
   00380 Tryptophan metabolism
    DM40_1245 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM40_1245 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM40_1245 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM40_1245 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcew04147]
    DM40_1245 (pcaF)
Enzymes [BR:bcew01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM40_1245 (pcaF)
Exosome [BR:bcew04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM40_1245 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AIO41911
Position
1:complement(1345526..1346728)
Genome map
AA seq 400 aa AA seqDB search
MIDAYICDAIRTPIGRYGGALKDVRADDLGAVPLRALIERNRDVDWTSIDDVIYGCANQA
GEDNRNVARMSALLAGLPTDVPGTTLNRLCGSGMDAVGTAARAIKAGEARLMIAGGVESM
TRAPFVMGKAATAFARQADIFDTTIGWRFINPLMKQRYGVDSMPETAENVAVDYNISRAD
QDLFALRSQQKAARAQQDGTLAEEIVPVTIAQKKGDALVVSRDEHPRETSLDALAKLKGV
VRPDGSVTAGNASGVNDGACALLLANAQAADQYRLRRRARVVGMATAGVEPRVMGIGPAP
ATQKLLRQLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTALHQLERTGGRFALCTMCIGVGQGIAIAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgcctacatctgcgatgcgattcgcacccccatcggccgctacggcggcgcc
ctgaaagacgttcgagccgatgatctcggcgcggtaccgctgagggcgctgatcgaacgc
aaccgcgacgtcgactggacatcgatcgacgacgtgatctatggctgcgcgaaccaggcc
ggggaagacaaccgcaacgtcgcgcgcatgtccgcactgctcgcgggtctgccgaccgac
gtgccgggcacgacactgaaccggctttgcggttcggggatggacgcggtcggcacggcc
gcgcgcgcgatcaaggccggcgaagcgcgattgatgatcgcgggcggcgtcgaaagcatg
acgcgcgcaccgttcgtaatgggcaaggccgccaccgcgttcgcgcgccaggccgacatt
ttcgacacgacgattggttggcgtttcatcaatccgctgatgaaacagcgatacggtgtc
gactcgatgcccgagacggccgagaacgtggccgtcgattacaacatcagccgtgccgac
caggatctgttcgcgctgcgcagccagcagaaggccgcgcgtgcgcagcaggacggcacg
ctcgccgaagaaatcgtgccggtcacgattgcgcagaagaaaggcgatgcgctcgtcgtg
tcgcgcgacgagcatccgcgcgagacgtcgctcgacgcgctcgcgaagctgaagggcgtc
gtgcgcccggacggctccgtcacggccggcaacgcgtcgggtgtcaacgatggcgcatgc
gcgctgctgctggccaacgcgcaggccgcggatcagtatcggctgcgccgccgcgcacgc
gtcgtcggcatggcgacggcaggggtcgagccgcgggtgatgggcatcggccctgcgccg
gccacgcagaaactgttgcgccagctcggcatgacgatcgaccagttcgacgtgatcgag
ctgaatgaagcattcgcatcccagggcctcgcggtgctgcgcatgctcggcgtcgccgac
gacgatccccgcgtgaacccgaacggcggtgcgatcgcgctcggccatccgctcggcgcg
tcgggcgcacgactcgtgacgacggcgcttcaccagctcgagcgtacgggcggccgtttt
gcgctttgtacgatgtgtatcggcgtcggtcagggcatcgcaatcgcgatcgaacgcgtg
taa

DBGET integrated database retrieval system