KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_1840Help
Entry
DM40_1840         CDS       T03488                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM40_1840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcew02000]
    DM40_1840
Transporters [BR:bcew02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DM40_1840
   Histidine transporter
    DM40_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIO42840
Position
1:1969622..1970311
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPVLWAGTVQTIELSLLSLATAVALGLIGAVAKLSHNRVLRAIATGYTTLIRSV
PDLVLMLLLFYSIQIWLNQLTDVVGWDQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLSV
PRGQLEAGAAYGMSGMRVFVRIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTFNMFFFILVAALIYLAITTVSNLVLIQLEKRYSMGVRHAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctttacggctttggtcccgtcctgtgggccggcaccgtgcagaccatcgagctg
tcgttgctgtcgctcgccactgcggtggcgctggggctgatcggcgcggtggcgaagctg
tcgcacaaccgggtgctgcgagcgatcgcgaccggttatacgacactgatccgctcggtg
cccgatctcgtcctgatgctgctgttgttctacagcatccagatctggctgaaccagctc
accgacgtcgtcggctgggaccagatcgacatcgatccgttcgtcgccggtgtgctcacg
ctcggcttcatctacggcgcgtatttcaccgagacgttccgcggcgcgttcctgtcggtg
ccgcgcgggcagctggaggccggcgcggcgtacgggatgagcgggatgcgcgtgttcgtg
cggatcatgtttccgcagatgatgcgtttcgcgctgccgggcatcggcaacaactggcag
gtgctcgtgaaagcgaccgcgctggtgtcgatcatcggcctcgcggacgtcgtgaaggcc
gcgcaggatgcgggcaagagcacgttcaacatgttcttcttcattctcgtcgcggcgctg
atctacctcgcgatcacgaccgtttccaacctcgtgctgatccagctcgagaagcgttat
tccatgggcgtgcggcacgcagaactatga

DBGET integrated database retrieval system