KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_22Help
Entry
DM40_22           CDS       T03488                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00030  Pentose phosphate pathway
bcew01100  Metabolic pathways
bcew01120  Microbial metabolism in diverse environments
bcew01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DM40_22
Enzymes [BR:bcew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     DM40_22
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776 GDP_Man_Dehyd PALP 3HCDH_N THF_DHG_CYH_C RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: AIO40822
Position
1:complement(25789..26559)
Genome map
AA seq 256 aa AA seqDB search
MKLQGIRALVTGADSGIGQAIATLFAQEGADVAIVYHTDHDGAQETVQRIEALGRRACAI
QGDVSDPQSVAAFFRDATTTLGGLEVLVNDAGVGAPGAAVADLEDTQIDTVLRTDLLGPL
YCCRAFVRQRRAAGGGGRIVNISSVAQHLPTPESAPYGMAKAGLGSLTRSLSREVAEDKI
NVNNIAPGLIDTPMTRDRLDDPHARDKSMSVIPWHRPGQPEEIARVALFLASDDGDYVTG
QTWTIDGGLTMQWGGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcaaggcattcgcgcgctcgtcacgggcgcggactccggaatcggtcaggcg
atcgcaacgttgtttgcgcaggaaggcgcggacgtcgcgatcgtctatcacacggaccac
gatggcgcgcaggaaaccgtgcagcgtatcgaggcactcggtcggcgcgcatgtgcgata
cagggcgacgtatcggatccgcaatcggttgccgctttctttcgcgacgcgacaaccacg
ctcggcgggcttgaagtgttggtaaacgacgcaggtgtcggcgcgcccggtgcggcggtc
gccgatctcgaggatacgcagatcgataccgtactgcggaccgatttgctcggcccgtta
tattgttgtcgcgcgttcgtgcggcaacgccgtgcggctggcggcggcgggcgcatcgtc
aatatctcgtcggtcgcgcaacatctgccgaccccggaaagcgcgccgtacgggatggcg
aaggcgggcctcggctcgcttacccgcagcctgtcccgcgaggtggcagaggacaagatc
aacgtcaacaacatcgcaccggggctcattgatacgccgatgacgcgcgatcgcctcgac
gacccgcacgcgcgggacaagtcgatgtcggtgattccgtggcatcggcccgggcagccc
gaggaaattgcgcgcgtcgcgctgtttcttgcatcggacgacggcgattacgtcaccggg
cagacatggacgatcgacggcggcctgacgatgcaatggggcggcgcgtga

DBGET integrated database retrieval system