KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_2388Help
Entry
DM40_2388         CDS       T03488                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00071  Fatty acid degradation
bcew00072  Synthesis and degradation of ketone bodies
bcew00280  Valine, leucine and isoleucine degradation
bcew00310  Lysine degradation
bcew00362  Benzoate degradation
bcew00380  Tryptophan metabolism
bcew00620  Pyruvate metabolism
bcew00630  Glyoxylate and dicarboxylate metabolism
bcew00640  Propanoate metabolism
bcew00650  Butanoate metabolism
bcew00900  Terpenoid backbone biosynthesis
bcew01100  Metabolic pathways
bcew01110  Biosynthesis of secondary metabolites
bcew01120  Microbial metabolism in diverse environments
bcew01130  Biosynthesis of antibiotics
bcew01200  Carbon metabolism
bcew01212  Fatty acid metabolism
bcew02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM40_2388
   00630 Glyoxylate and dicarboxylate metabolism
    DM40_2388
   00640 Propanoate metabolism
    DM40_2388
   00650 Butanoate metabolism
    DM40_2388
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM40_2388
   00072 Synthesis and degradation of ketone bodies
    DM40_2388
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM40_2388
   00310 Lysine degradation
    DM40_2388
   00380 Tryptophan metabolism
    DM40_2388
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM40_2388
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM40_2388
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM40_2388
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcew04147]
    DM40_2388
Enzymes [BR:bcew01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM40_2388
Exosome [BR:bcew04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM40_2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIO40262
Position
1:complement(2586926..2588107)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKVAAPELGATVIRAVLERAGVKPDQVSEVIMGQVLTAG
SGQNPARQSLIKAGLPNAVPGMTINKVCGSGLKAVMLAANAIIAGDAEIVIAGGQENMSA
APHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREEQDAFAA
LSQNKAEAAQKAGRFNDEIVPVAIPQRKGEPVQFATDEFVRHGVTAESLAGLKPAFAKDG
SVTAANASGLNDGAAAVLVMSAQKAAALGLTPLARIKAYANAGVDPSVMGMGPVPASRRA
LERAGWTPGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMVKRDAKRGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtagtgatcgtatcggccgcgcggaccgcggtcggcaaattcggcggctcg
ctcgcgaaggttgcggcaccggagctgggcgcgacggtgattcgtgcggtgctggagcgt
gcgggcgtgaagcccgaccaggtgagcgaagtgatcatgggccaggtgctgacggcgggc
tccgggcagaacccggcgcgccagtcgctgatcaaggccggcctgccgaatgcggtgccg
ggcatgacgatcaacaaggtgtgcggttcgggcctgaaggccgtgatgctcgcggcgaac
gcgatcattgcgggcgatgcggagatcgtgatcgccggcggccaggaaaacatgagcgca
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggtgatgcgaagctggtc
gacacgatgatcgtcgacgggttgtgggacgtgtacaaccagtaccacatggggatcacc
gcggagaacgttgcgaaggaatacgggatcacgcgcgaggagcaggacgcgttcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaggccggccgtttcaacgacgagatcgtg
ccggtggcgattccgcagcgcaagggcgagccggtgcaattcgcgaccgacgaattcgtg
cgccacggcgtgacggcagaatcgctggcggggttgaagcccgcgttcgcgaaggacggg
tcggtgacggcggcgaatgcgtcggggctgaacgacggcgcggcggcggtgctggtgatg
tcggcgcagaaggcggcggcgctgggtctgacgccgcttgcgcggatcaaggcgtacgcg
aacgcgggcgtggatccgagcgtgatgggcatgggtccggtgccggcgtcgcgccgtgcg
ctggagcgcgcgggctggacgccgggcgacctggacctgatggaaatcaacgaagcgttc
gcggcgcaggcgctggcggtgcacaagcagatgggctgggacacgtcgaaggtgaacgtg
aacggcggggcgatcgcgatcggccacccgatcggcgcgtcgggctgccggatcctggtg
acgctgctgcacgagatggtcaagcgcgacgcgaagcgcgggttggcgtcgctgtgcatc
ggcggcgggatgggcgtcgcgctcgcggtcgagcgtccgtaa

DBGET integrated database retrieval system