KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_3591Help
Entry
DM40_3591         CDS       T03488                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00053  Ascorbate and aldarate metabolism
bcew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DM40_3591
Enzymes [BR:bcew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     DM40_3591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 adh_short Ldh_1_N NmrA
Motif
Other DBs
NCBI-ProteinID: AIO38517
Position
2:674841..675677
Genome map
AA seq 278 aa AA seqDB search
MNATSTGARKPFRRVLLTGAAGNLGRQLRGALANWADIVRVSDIAALDAAAAHEEARVVD
LADRPAVMDLVDGVDAIVHLGGISVDAPFDDLVDANITGTYNLYEAARKYGVKRIVFASS
NHAIGFHPVTEVLDADSPLRPDSLYGVTKCFGESLSRYYFDRFGIETVCLRIGSSFEVPK
NPRMLVTYLSYRDFIELVRCSLLTNRVGHAIVYGASDNPVKWWDNAKVAFLGFRPQDSSE
QFAGLFPVTAPTADYDDPAQRYQGGGFVVGEPMERDAK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacctccaccggcgcacgcaagccgttccggcgcgtgctgctgaccggcgcg
gccggcaacctcggccggcagttgcgcggcgcgctggcgaactgggccgacatcgtgcgc
gtgagcgacatcgccgcgctcgacgcagcggccgcgcatgaagaagccagggtcgtggac
ctggcggaccggcctgcggtgatggacctcgtcgacggcgtcgacgcgatcgtccatctg
ggcgggatttcggtcgatgcgccgttcgacgatctcgtcgacgcgaacatcaccggcacg
tacaacctgtacgaagccgcgcgcaagtacggcgtgaaacggatcgtgttcgcgagctcg
aaccatgcgatcggtttccacccggtgacggaagtgctcgatgcggattcgccgttgcgt
ccggacagtctctatggcgtgacgaagtgcttcggcgagtcgctgtcgcgctattacttc
gaccgcttcgggatcgagacggtgtgcctgcggatcggctcatcgttcgaagtcccgaag
aatccgcgaatgctcgtgacctatctcagctatcgcgacttcatcgagctcgtgcgctgc
tcgttgctgacgaaccgcgtcgggcacgcgattgtctacggcgcgtcggataacccggtg
aagtggtgggacaacgcgaaagtcgcgttcctcggcttccggccgcaggacagctccgag
cagttcgccgggctgttcccggtgacggcgccgaccgctgactacgacgatccggcgcag
cgctaccagggcggcggtttcgtcgtcggcgagccgatggagcgcgacgcgaaataa

DBGET integrated database retrieval system